COQ2 Antibody

Images

 
Independent Antibodies: Western Blot: COQ2 Antibody [NBP2-56780] - Analysis NBP2-56780 (A) shows similar pattern to independent antibody NBP2-49563 (B).
Immunocytochemistry/ Immunofluorescence: COQ2 Antibody [NBP2-56780] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

COQ2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSGQTAPYYAALGAVGAHLTHQIYTLDIHRPEDCWNKFI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COQ2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COQ2 Recombinant Protein Antigen (NBP2-56780PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for COQ2 Antibody

  • 4-hydroxybenzoate polyprenyltransferase
  • coenzyme Q2 homolog, prenyltransferase (yeast)
  • COQ2 homolog
  • EC 2.5.1
  • EC 2.5.1.39
  • FLJ13014
  • hCOQ2
  • mitochondrial
  • Para-hydroxybenzoate--polyprenyltransferase
  • para-hydroxybenzoate-polyprenyltransferase, mitochondrial
  • PHB:polyprenyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01512
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-85511
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF3470
Species: Hu
Applications: ICC, WB
NBP2-75624
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB100-74482
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-83950
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-88450
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92275
Species: Hu
Applications: IHC, IHC-P
NBP2-41176
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
H00001350-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP2-13859
Species: Hu
Applications: IHC, IHC-P, WB

Publications for COQ2 Antibody (NBP2-56780) (0)

There are no publications for COQ2 Antibody (NBP2-56780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COQ2 Antibody (NBP2-56780) (0)

There are no reviews for COQ2 Antibody (NBP2-56780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COQ2 Antibody (NBP2-56780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COQ2 Products

Array NBP2-56780

Bioinformatics Tool for COQ2 Antibody (NBP2-56780)

Discover related pathways, diseases and genes to COQ2 Antibody (NBP2-56780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COQ2 Antibody (NBP2-56780)

Discover more about diseases related to COQ2 Antibody (NBP2-56780).
 

Pathways for COQ2 Antibody (NBP2-56780)

View related products by pathway.

PTMs for COQ2 Antibody (NBP2-56780)

Learn more about PTMs related to COQ2 Antibody (NBP2-56780).

Blogs on COQ2

There are no specific blogs for COQ2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COQ2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COQ2