AASD-PPT Antibody

Images

 
Western Blot: AASD-PPT Antibody [NBP1-89322] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: AASD-PPT Antibody [NBP1-89322] - Staining of human testis shows strong cytoplasmic positivity in spermatids.
Western Blot: AASD-PPT Antibody [NBP1-89322] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-9

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AASD-PPT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AASDHPPT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
AASD-PPT Protein (NBP1-89322PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AASD-PPT Antibody

  • 4'-phosphopantetheinyl transferase
  • AASD-PPTDKFZp566E2346
  • Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase
  • aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
  • CGI-80
  • EC 2.7.8
  • EC 2.7.8.-
  • L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
  • LYS2
  • LYS5 ortholog
  • LYS5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25143
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
H00008847-P01
Species: Hu
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
26660002
Species: Hu
Applications: ELISA, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-60949
Species: AB, Bv, Gt, Sh, WB
Applications: Flow, Func, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46538
Species: Hu
Applications: WB, IHC
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56552
Species: Hu
Applications: WB
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-89322
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for AASD-PPT Antibody (NBP1-89322) (0)

There are no publications for AASD-PPT Antibody (NBP1-89322).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AASD-PPT Antibody (NBP1-89322) (0)

There are no reviews for AASD-PPT Antibody (NBP1-89322). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AASD-PPT Antibody (NBP1-89322) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AASD-PPT Products

Bioinformatics Tool for AASD-PPT Antibody (NBP1-89322)

Discover related pathways, diseases and genes to AASD-PPT Antibody (NBP1-89322). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AASD-PPT Antibody (NBP1-89322)

Discover more about diseases related to AASD-PPT Antibody (NBP1-89322).

Blogs on AASD-PPT

There are no specific blogs for AASD-PPT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AASD-PPT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AASDHPPT
Entrez
Uniprot