AASD-PPT Antibody

Western Blot: AASD-PPT Antibody [NBP1-89322] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: AASD-PPT Antibody [NBP1-89322] - Staining of human testis shows strong cytoplasmic positivity in spermatids.

Western Blot: AASD-PPT Antibody [NBP1-89322] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-9

• Reactivity: Hu, Mu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

AASD-PPT Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AASDHPPT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  AASD-PPT Protein (NBP1-89322PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AASD-PPT Antibody

• 4'-phosphopantetheinyl transferase
• AASD-PPTDKFZp566E2346
• Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase
• aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
• CGI-80
• EC 2.7.8
• EC 2.7.8.-
• L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
• LYS2
• LYS5 ortholog
• LYS5

Background

AASDHPPT is encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AASDHPPT
• Entrez:
  • 60496(Human)
• Uniprot:
  • Q9NRN7(Human)