UQCRQ Antibody - BSA Free

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Western Blot: UQCRQ Antibody [NBP2-86043] - WB Suggested Anti-UQCRQ Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Liver

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human Fetal Kidney. Antibody Dilution: 1.0ug/ml

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human Hela. Antibody Dilution: 1.0ug/mlUQCRQ is supported by BioGPS gene expression data to be expressed in HeLa

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human 721_B. Antibody Dilution: 1.0ug/mlUQCRQ is supported by BioGPS gene expression data to be expressed in 721_B

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human MCF7. Antibody Dilution: 1.0ug/mlUQCRQ is supported by BioGPS gene expression data to be expressed in MCF7

Immunoprecipitation: UQCRQ Antibody [NBP2-86043] - UQCRQ was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with with 1:200 dilution. Western blot was performed using NBP2-86043 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: UQCRQ IP in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

• Reactivity: Hu
• Applications: WB, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

UQCRQ Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UQCRQ Antibody - BSA Free (NBP2-86043) is a polyclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human UQCRQ. Peptide sequence: KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UQCRQ
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for UQCRQ Antibody - BSA Free

• complex III subunit 8
• cytochrome b-c1 complex subunit 8
• low molecular mass ubiquinone-binding protein (9.5kD)
• QPC
• ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C
• ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa
• UQCR7

Background

The UQCRQ gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UQCRQ