Independent Antibodies: Western Blot: ALDH18A1 Antibody [NBP1-83324] - Analysis using Anti-ALDH18A1 antibody NBP1-83324 (A) shows similar pattern to independent antibody NBP1-83325 (B).
Immunocytochemistry/ Immunofluorescence: ALDH18A1 Antibody [NBP1-83324] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human gastrointestinal shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human liver shows no positivity in hepatocytes as expected.
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
This antibody was developed against Recombinant Protein corresponding to amino acids: SVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH18A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
ALDH18A1, or Delta-1-pyrroline-5-carboxylate synthase, contains a long 88 kDa and a short 87 kDa isoform, and is involved in the catalytic conversion of glutamate to glutamate 5-semialdehyde. Current research on ALDH18A1 is being conducted to determine the relation between the protein and a variety of diseases and disorders, including neurodegeneration, pneumonia, connective tissue disease, mental retardation, hypoornithinemia, tuberculosis, microcephaly, Alzheimer's disease, gastroesophageal reflux disease, and dementia. The protein has been linked to biosynthesis and metabolic pathways where it interacts with PUS1, UQCRFS1, ICT1, OAT, and MYC.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for ALDH18A1 Antibody (NBP1-83324). (Showing 1 - 1 of 1 FAQs).
I am looking for mouse Aldh18a1 antibody suitable for immunohistochemistry, and find your antibodies NBP1-83324 and NBP1-83325. Do you have the data of WB or IHC using these antibodies against mouse samples? If not, I would like to test them in our samples. It would be great if you could give us an aliquot of them, and we will let you know the outcomes.
For our two products NBP1-83324 and NBP1-83325, we have not yet tested these products for detection of the mouse protein. I did run alignments of our antigens against the mouse sequence. Both sequences have a high homology to the mouse sequence. Since we have not yet tested these against mouse samples, you would qualify for our Innovator's Reward program. In exchange for a review of these products in your experiment, we would issue you a credit for the purchase price of the antibody. Regardless of results. Due to our Innovator's Reward Program, we do not offer free aliquots of our products. I am sorry for any inconvenience.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our ALDH18A1 Antibody - BSA Free and receive a gift card or discount.