ALDH18A1 Antibody

Images

 
Western Blot: ALDH18A1 Antibody [NBP1-83324] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: ALDH18A1 Antibody [NBP1-83324] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: ALDH18A1 Antibody [NBP1-83324] - Analysis in human cell line HepG2.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALDH18A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH18A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALDH18A1 Protein (NBP1-83324PEP)
Publications
Read Publication using NBP1-83324.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALDH18A1 Antibody

  • aldehyde dehydrogenase 18 family, member A1
  • Aldehyde dehydrogenase family 18 member A1
  • delta-1-pyrroline-5-carboxylate synthase
  • EC 2.1.2.11
  • EC 2.3.3.13
  • GSASdelta1-pyrroline-5-carboxlate synthetase
  • MGC117316
  • P5CSdelta-1-pyrroline-5-carboxylate synthetase
  • PYCSEC 1.2.1.41
  • pyrroline-5-carboxylate synthetase (glutamate gamma-semialdehyde synthetase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-2832
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00008659-D01P
Species: Hu, Mu
Applications: WB
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP2-58924
Species: Hu
Applications: ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-31730
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009815-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
H00005545-R02
Species: Hu
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF4079
Species: Hu
Applications: WB, ICC
NBP1-83324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ALDH18A1 Antibody (NBP1-83324)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ALDH18A1 Antibody (NBP1-83324) (0)

There are no reviews for ALDH18A1 Antibody (NBP1-83324). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ALDH18A1 Antibody (NBP1-83324). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for mouse Aldh18a1 antibody suitable for immunohistochemistry, and find your antibodies NBP1-83324 and NBP1-83325. Do you have the data of WB or IHC using these antibodies against mouse samples? If not, I would like to test them in our samples. It would be great if you could give us an aliquot of them, and we will let you know the outcomes.
    • For our two products NBP1-83324 and NBP1-83325, we have not yet tested these products for detection of the mouse protein. I did run alignments of our antigens against the mouse sequence. Both sequences have a high homology to the mouse sequence. Since we have not yet tested these against mouse samples, you would qualify for our Innovator's Reward program. In exchange for a review of these products in your experiment, we would issue you a credit for the purchase price of the antibody. Regardless of results. Due to our Innovator's Reward Program, we do not offer free aliquots of our products. I am sorry for any inconvenience.

Secondary Antibodies

 

Isotype Controls

Additional ALDH18A1 Products

Bioinformatics Tool for ALDH18A1 Antibody (NBP1-83324)

Discover related pathways, diseases and genes to ALDH18A1 Antibody (NBP1-83324). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH18A1 Antibody (NBP1-83324)

Discover more about diseases related to ALDH18A1 Antibody (NBP1-83324).
 

Pathways for ALDH18A1 Antibody (NBP1-83324)

View related products by pathway.

Blogs on ALDH18A1

There are no specific blogs for ALDH18A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALDH18A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH18A1
Entrez
Uniprot