AKR1A1 Antibody


Western Blot: AKR1A1 Antibody [NBP1-89121] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: AKR1A1 Antibody [NBP1-89121] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: AKR1A1 Antibody [NBP1-89121] - Staining of human pancreas shows cytoplasmic positivity both in exocrine glandular cells and islet cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

AKR1A1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAH
Specificity of human AKR1A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
AKR1A1 Lysate (NBP2-65587)
Control Peptide
AKR1A1 Protein (NBP1-89121PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for AKR1A1 Antibody

  • alcohol dehydrogenase [NADP+]
  • alcohol dehydrogenase
  • Aldehyde reductase
  • Aldo-keto reductase family 1 member A1
  • aldo-keto reductase family 1, member A1 (aldehyde reductase)
  • ALDR1
  • ALRMGC1380
  • ARM
  • DD3
  • dihydrodiol dehydrogenase 3
  • EC 1.1.1
  • EC
  • MGC12529


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for AKR1A1 Antibody (NBP1-89121) (0)

There are no publications for AKR1A1 Antibody (NBP1-89121).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKR1A1 Antibody (NBP1-89121) (0)

There are no reviews for AKR1A1 Antibody (NBP1-89121). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AKR1A1 Antibody (NBP1-89121) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional AKR1A1 Products

Bioinformatics Tool for AKR1A1 Antibody (NBP1-89121)

Discover related pathways, diseases and genes to AKR1A1 Antibody (NBP1-89121). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKR1A1 Antibody (NBP1-89121)

Discover more about diseases related to AKR1A1 Antibody (NBP1-89121).

Pathways for AKR1A1 Antibody (NBP1-89121)

View related products by pathway.

PTMs for AKR1A1 Antibody (NBP1-89121)

Learn more about PTMs related to AKR1A1 Antibody (NBP1-89121).

Research Areas for AKR1A1 Antibody (NBP1-89121)

Find related products by research area.

Blogs on AKR1A1

There are no specific blogs for AKR1A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AKR1A1 Antibody and receive a gift card or discount.


Gene Symbol AKR1A1