AK3 Antibody

Images

 
Western Blot: AK3 Antibody [H00050808-D01P] - Analysis of AK3 expression in HeLa.
Western Blot: AK3 Antibody [H00050808-D01P] - Analysis of AK3 expression in transfected 293T cell line by AK3 polyclonal antibody.Lane 1: AK3 transfected lysate(25.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AK3 Antibody Summary

Immunogen
AK3 (NP_057366.2, 1 a.a. - 227 a.a.) full-length human protein. MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
Specificity
AK3 - adenylate kinase 3,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AK3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AK3 Antibody

  • Adenylate kinase 3 alpha-like 1
  • adenylate kinase 3 like 1
  • adenylate kinase 3adenylate kinase 6
  • AK 3
  • AK6
  • AKL3L
  • AKL3L1
  • EC 2.7.4
  • EC 2.7.4.10
  • FIX
  • GTP:AMP phosphotransferase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87401
Species: Hu, Mu, Rt, RM
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33160
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00827
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87677
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02978
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00002592-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-59656
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00970
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-83239
Species: Bv, Hu
Applications: IHC, IHC-P, WB
NB500-525
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-03107
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB6918
Species: Hu
Applications: WB
NBP1-86072
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-32601
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-41266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-48336
Species: Bv, Hu, Mu, Po
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00002023-M01
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
H00050808-D01P
Species: Hu
Applications: WB

Publications for AK3 Antibody (H00050808-D01P) (0)

There are no publications for AK3 Antibody (H00050808-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AK3 Antibody (H00050808-D01P) (0)

There are no reviews for AK3 Antibody (H00050808-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AK3 Antibody (H00050808-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AK3 Products

Array H00050808-D01P

Bioinformatics Tool for AK3 Antibody (H00050808-D01P)

Discover related pathways, diseases and genes to AK3 Antibody (H00050808-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AK3 Antibody (H00050808-D01P)

Discover more about diseases related to AK3 Antibody (H00050808-D01P).
 

Pathways for AK3 Antibody (H00050808-D01P)

View related products by pathway.

PTMs for AK3 Antibody (H00050808-D01P)

Learn more about PTMs related to AK3 Antibody (H00050808-D01P).

Blogs on AK3

There are no specific blogs for AK3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AK3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AK3
Entrez
Uniprot