AGTRAP Antibody - Azide and BSA Free

Western Blot: AGTRAP Antibody [NBP2-92060] - Analysis of extracts of various cell lines, using AGTRAP at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: AGTRAP Antibody - Azide and BSA Free [NBP2-92060] - Immunofluorescence analysis of U2OS cells using AGTRAP Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

AGTRAP Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit AGTRAP Antibody - Azide and BSA Free (NBP2-92060) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 93-152 of human AGTRAP (NP_065083.3). ILSLLLKPLSCCFVYHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AGTRAP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for AGTRAP Antibody - Azide and BSA Free

• angiotensin II receptor-associated protein
• AT1 receptor-associated protein
• ATI receptor-associated protein
• MGC29646
• type I receptor-associated protein
• type-1 angiotensin II receptor-associated protein

Background

AGTRAP encodes a transmembrane protein localized to the plasma membrane and perinuclear vesicular structures. The gene product interacts with the angiotensin II type I receptor and negatively regulates angiotensin II signaling. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: AGTRAP