ARAP1 Antibody

Images

 
Western Blot: ARAP1 Antibody [NBP2-56429] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: ARAP1 Antibody [NBP2-56429] - Staining of human cell line HaCaT shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: ARAP1 Antibody [NBP2-56429] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARAP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYFDSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERK
Specificity
Specificity of human ARAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARAP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARAP1 Recombinant Protein Antigen (NBP2-56429PEP)

Reactivity Notes

Mouse 80%, Rat 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ARAP1 Antibody

  • arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
  • ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1
  • centaurin, delta 2
  • Centaurin-delta-2
  • CENTD2ARF-GAP, RHO-GAP, ankyrin repeat, and pleckstrin homology domains-containingprotein 1
  • cnt-d2
  • KIAA0782centaurin-delta-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PAGE
H00057085-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi, S-ELISA
NB600-261
Species: Hu, Mu
Applications: WB, ChIP, Flow, IP
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-87473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-31227
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057509-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-1699
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
NBP1-90060
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr

Publications for ARAP1 Antibody (NBP2-56429) (0)

There are no publications for ARAP1 Antibody (NBP2-56429).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARAP1 Antibody (NBP2-56429) (0)

There are no reviews for ARAP1 Antibody (NBP2-56429). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARAP1 Antibody (NBP2-56429) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARAP1 Products

Bioinformatics Tool for ARAP1 Antibody (NBP2-56429)

Discover related pathways, diseases and genes to ARAP1 Antibody (NBP2-56429). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARAP1 Antibody (NBP2-56429)

Discover more about diseases related to ARAP1 Antibody (NBP2-56429).
 

Pathways for ARAP1 Antibody (NBP2-56429)

View related products by pathway.

PTMs for ARAP1 Antibody (NBP2-56429)

Learn more about PTMs related to ARAP1 Antibody (NBP2-56429).
 

Research Areas for ARAP1 Antibody (NBP2-56429)

Find related products by research area.

Blogs on ARAP1

There are no specific blogs for ARAP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARAP1