AGTRAP Antibody


Immunocytochemistry/ Immunofluorescence: AGTRAP Antibody [NBP1-91654] - Staining of human cell line A-431 shows positivity in vesicles.
Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

AGTRAP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGY
Specificity of human AGTRAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500-1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AGTRAP Protein (NBP1-91654PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for AGTRAP Antibody

  • angiotensin II receptor-associated protein
  • AT1 receptor-associated protein
  • ATI receptor-associated protein
  • MGC29646
  • type I receptor-associated protein
  • type-1 angiotensin II receptor-associated protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AGTRAP Antibody (NBP1-91654) (0)

There are no publications for AGTRAP Antibody (NBP1-91654).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGTRAP Antibody (NBP1-91654) (0)

There are no reviews for AGTRAP Antibody (NBP1-91654). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AGTRAP Antibody (NBP1-91654) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for AGTRAP Antibody (NBP1-91654)

Discover related pathways, diseases and genes to AGTRAP Antibody (NBP1-91654). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGTRAP Antibody (NBP1-91654)

Discover more about diseases related to AGTRAP Antibody (NBP1-91654).

Pathways for AGTRAP Antibody (NBP1-91654)

View related products by pathway.

PTMs for AGTRAP Antibody (NBP1-91654)

Learn more about PTMs related to AGTRAP Antibody (NBP1-91654).

Blogs on AGTRAP

There are no specific blogs for AGTRAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AGTRAP Antibody and receive a gift card or discount.


Gene Symbol AGTRAP