Home » AG-2/AGR2 » AG-2/AGR2 Antibodies » AG-2/AGR2 Antibody

AG-2/AGR2 Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: AG-2 Antibody [NBP1-89212] - Analysis in human cell lines A-549 and HEK293 using anti-AGR2 antibody. Corresponding AGR2 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Orthogonal Strategies: Western Blot: AG-2 Antibody [NBP1-89212] - Analysis in human cell lines A-549 and HEK293 using anti-AGR2 antibody. Corresponding AGR2 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: AG-2 Antibody [NBP1-89212] - Staining of human cell line RT4 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AG-2 Antibody [NBP1-89212] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: AG-2 Antibody [NBP1-89212] - Analysis in human stomach and skeletal muscle tissues. Corresponding AGR2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AG-2 Antibody [NBP1-89212] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: AG-2 Antibody [NBP1-89212] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: AG-2 Antibody [NBP1-89212] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

AG-2/AGR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGR
Specificity
Specificity of human AG-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AG-2/AGR2 Recombinant Protein Antigen (NBP1-89212PEP)
Publications
Read Publications using NBP1-89212.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AG-2/AGR2 Antibody

  • AG2
  • AG-2
  • AG2member 17
  • AGR2
  • anterior gradient 2 homolog (Xenopus laevis)
  • anterior gradient homolog 2 (Xenopus laevis)
  • GOB-4
  • hAG-2
  • HPC8
  • PDIA17
  • secreted cement gland homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ER alpha/NR3A1
Antibody (6A6E8)
NBP2-61764
Western Blot: ER alpha/NR3A1 Antibody (6A6E8) [NBP2-61764] - Analysis using ESR1 mAb against HEK293 (1) and ESR1 (AA: 2-185)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: ER alpha/NR3A1 Antibody (6A6E8) [NBP2-61764] - Analysis of Hela cells using ESR1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin. Goat anti-Mouse IgG (H+L) DyLight 488 secondary antibody was used.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (6A6E8) [NBP2-61764] - Analysis of esophageal cancer tissues using ESR1 mouse mAb with DAB staining.
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AG-3/AGR3 Antibody
NBP2-15307
Western Blot: AG-3/AGR3 Antibody [NBP2-15307] - Sample (30 ug of whole cell lysate) A: A549 B: MCF-7 12% SDS PAGE; antibody diluted at 1:1000.
Immunohistochemistry-Paraffin: AG-3/AGR3 Antibody [NBP2-15307] - Paraffin-embedded rat colon diluted at 1:500.
Immunohistochemistry: AG-3/AGR3 Antibody [NBP2-15307] - Paraffin-embedded HBL435 xenograft; antibody dilution 1:500.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(25 Publications)
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
TXNDC12 Antibody
NBP2-93457
Western Blot: TXNDC12 Antibody [NBP2-93457] - Analysis of extracts of various cell lines, using TXNDC12 at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: TXNDC12 Antibody [NBP2-93457] - Analysis of U-2 OS cells using TXNDC12. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: TXNDC12 Antibody [NBP2-93457] - Analysis of NIH-3T3 cells using TXNDC12. Blue: DAPI for nuclear staining.
Species: Hu, Mu
Applications: WB, ICC/IF
MUC2 Antibody
(CCP58)
NBP2-25221
Western Blot: MUC2 Antibody (CCP58) [NBP2-25221] - MDA MB 231 cells and HCC827 human non-small cell lung cancer cell line lysates. Image from verified customer review.
Immunohistochemistry-Paraffin: MUC2 Antibody (CCP58) [NBP2-25221] - Formalin-fixed, paraffin-embedded human Colon Carcinoma stained with MUC2 Antibody (CCP58).
Immunohistochemistry-Paraffin: MUC2 Antibody (CCP58) [NBP2-25221] - Formalin-fixed, paraffin-embedded normal human intestine (10X) stained with MUC2 antibody (1:200), peroxidase-conjugate and DAB chromogen.
(3 Reviews)
(3 Publications)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
TXNDC15 Antibody
NBP1-89394
Immunocytochemistry/Immunofluorescence: TXNDC15 Antibody [NBP1-89394] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: TXNDC15 Antibody [NBP1-89394] - Staining of human colon shows cytoplasmic positivity with a granular pattern in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, Jurkat human acute T cell leukemia cell line, and K562 human chronic myelogenous leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for HNF‑3 beta /FoxA2 at approximately 48 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Mouse splenocytes were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. HNF‑3 beta /FoxA2/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The E-RABP promoter was detected by standard PCR.
HNF‑3 beta /FoxA2 was detected in immersion fixed endoderm differentiated BG01V human embryonic stem cells using 10 µg/mL Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(36 Publications)
Species: Hu
Applications: WB, IHC, ChIP, ICC
Amphiregulin [HRP]
DAR00
(5 Reviews)
(8 Publications)
Species: Hu
Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(13 Publications)
Species: Hu
SPDEF Antibody
NBP2-56499
Immunocytochemistry/Immunofluorescence: SPDEF Antibody [NBP2-56499] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF
Cytokeratin 19
Antibody
NB100-687
Simple Western: Cytokeratin 19 Antibody [NB100-687] - Lane view shows a specific band for Cytokeratin 19 in 0.5 mg/ml of HepG2 lysate. This experiment was performed under reducing A246 conditions using the 12-230 kDa separation system.
Western Blot: Cytokeratin 19 Antibody [NB100-687] - Western blot detection of YAP and TAZ in proteins extracted from isolated hepatocytes and cholangiocytes and total liver tissue. Antibodies against CK19 and HNF4a were used to confirm purity of the populations and b-actin was used as a loading control. Representative results from a single experiment with n = 3 independent cell isolations and n = 2 total liver tissues. Image collected and cropped by CiteAb from the following publication(http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201506089), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Cytokeratin 19 Antibody [NB100-687] - TUDCA induces intermediate states of mesenchymal and epithelial cells in primary cultures of rat HSC during hepatic differentiation. Under control conditions HSC remained negative for K19 (Cytokeratin 19) expression, (d) but this epithelial marker protein was induced in HSC cultures after treatment with 2 uM TUDCA for 14 days (red). (f) K19 was found to be co-expressed with desmin (green), which indicated the origin of epithelial progenitor cells from HSC. (I) Cells with different states of maturation were still found after 21 days of TUDCA treatment. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep13320), licensed under a CC-BY licence.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
EGFR Antibody
[Unconjugated]
AF1280
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for EGFR at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
EGFR was detected in immersion fixed frozen sections of mouse embryo (13 d.p.c.) using Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to developing muscle. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EGFR at approximately 180-191 kDa (as indicated) using 2.5 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Review)
(7 Publications)
Species: Mu
Applications: WB, Simple Western, IHC
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(9 Reviews)
(42 Publications)
Species: Hu
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Western Blot: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of Cytokeratin 20 on different cell lysates using anti-Cytokeratin 20 antibody at 1/1,000 dilution. Positive control: Lane 1: Lovo Lane 2: HCT116 Lane 3: CRC
Immunocytochemistry/Immunofluorescence: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Staining Cytokeratin 20 in CRC cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of paraffin-embedded rat small intestine tissue using anti-Cytokeratin 20 antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MUC5AC Antibody
(45M1)
NBP2-15196
Western Blot: MUC5AC Antibody (45M1) [NBP2-15196] - AGS human gastric adenocarcinoma and KATO-III human gastric carcinoma cell line lysates. Image from verified customer review.
Immunohistochemistry-Paraffin: MUC5AC Antibody (45M1) [NBP2-15196] - Formalin-fixed, paraffin-embedded human Gastric Carcinoma stained with MUC5AC Monoclonal Antibody (45M1).
Flow Cytometry: MUC5AC Antibody (45M1) [NBP2-15196] - An intracellular stain was performed on A549 cells with Mucin 5AC (45M1) antibody NBP2-15196PE (blue) and a matched isotype control NBP2-27287PE (orange). To block the secretion of Mucin 5AC, cells were treated with 3uM Monensin for 3 hours. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature. Both Antibodies were conjugated to Phycoerythrin.
(4 Reviews)
(7 Publications)
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
TFF1/pS2 Antibody
NBP1-90813
Western Blot: TFF1/pS2 Antibody [NBP1-90813] - Analysis in ysate from HEK293 cells. Image from a verified customer review.
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining in human stomach and liver tissues using anti-TFF1 antibody. Corresponding TFF1 RNA-seq data are presented for the same tissues.
Western Blot: TFF1/pS2 Antibody [NBP1-90813] - Analysis in control (vector only transfected HEK293T lysate) and TFF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
(1 Review)
(4 Publications)
Species: Hu
Applications: WB, IHC, IHC-P

Publications for AG-2/AGR2 Antibody (NBP1-89212)(2)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for AG-2/AGR2 Antibody (NBP1-89212) (0)

There are no reviews for AG-2/AGR2 Antibody (NBP1-89212). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AG-2/AGR2 Antibody (NBP1-89212) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional AG-2/AGR2 Products

Bioinformatics Tool for AG-2/AGR2 Antibody (NBP1-89212)

Discover related pathways, diseases and genes to AG-2/AGR2 Antibody (NBP1-89212). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AG-2/AGR2 Antibody (NBP1-89212)

Discover more about diseases related to AG-2/AGR2 Antibody (NBP1-89212).
 

Pathways for AG-2/AGR2 Antibody (NBP1-89212)

View related products by pathway.

PTMs for AG-2/AGR2 Antibody (NBP1-89212)

Learn more about PTMs related to AG-2/AGR2 Antibody (NBP1-89212).
 

Research Areas for AG-2/AGR2 Antibody (NBP1-89212)

Find related products by research area.

Blogs on AG-2/AGR2

There are no specific blogs for AG-2/AGR2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AG-2/AGR2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AGR2
COVID-19 update