TXNDC12 Antibody - Azide and BSA Free

Western Blot: TXNDC12 Antibody [NBP2-93457] - Analysis of extracts of various cell lines, using TXNDC12 at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: TXNDC12 Antibody [NBP2-93457] - Analysis of U-2 OS cells using TXNDC12 . Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: TXNDC12 Antibody [NBP2-93457] - Human liver cancer using TXNDC12 Rabbit pAb at dilution of 1:100 (40x lens).

Immunocytochemistry/Immunofluorescence: TXNDC12 Antibody [NBP2-93457] - Analysis of NIH-3T3 cells using TXNDC12 . Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: TXNDC12 Antibody [NBP2-93457] - Rat brain using TXNDC12 Rabbit pAb at dilution of 1:100 (40x lens).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TXNDC12 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 93-172 of human TXNDC12 (NP_056997.1). NLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TXNDC12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:50-1:100
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
• Theoretical MW: 19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TXNDC12 Antibody - Azide and BSA Free

• AG1
• AGR1
• anterior gradient homolog 1
• EC 1.8.4.2
• endoplasmic reticulum protein ERp19
• Endoplasmic reticulum resident protein 18
• Endoplasmic reticulum resident protein 19
• endoplasmic reticulum thioredoxin superfamily member, 18 kDa
• ER protein 18
• ER protein 19
• ERP16
• ERp18
• ERP18AG1
• ERP19
• hAG-1
• hTLP19
• PDIA16
• protein disulfide isomerase family A, member 16
• thioredoxin domain containing 12 (endoplasmic reticulum)
• thioredoxin domain-containing protein 12
• Thioredoxin-like protein p19
• TLP19
• TLP19hTLP19
• TXNDC12 thioredoxin domain containing 12 (endoplasmic reticulum)

Background

TXNDC12 belongs to the thioredoxin superfamily (see TXN; MIM 187700). Members of this superfamily possess a thioredoxin fold with a consensus active-site sequence (CxxC) and have roles in redox regulation, defense against oxidative stress, refolding of disulfide-containing proteins, and regulation of transcription factors (Liu et al., 2003 (PubMed 14557066)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TXNDC12