Afadin/AF-6 Antibody


Immunocytochemistry/ Immunofluorescence: Afadin/AF-6 Antibody [NBP2-55781] - Staining of human cell line U-2 OS shows localization to plasma membrane & cell junctions.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF

Order Details

Afadin/AF-6 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDS
Specificity of human Afadin/AF-6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Afadin/AF-6 Recombinant Protein Antigen (NBP2-55781PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Afadin/AF-6 Antibody

  • AF6
  • AF-6
  • AF64
  • AFAD
  • Afadin
  • FLJ34371
  • MLLT4
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, ICC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Afadin/AF-6 Antibody (NBP2-55781) (0)

There are no publications for Afadin/AF-6 Antibody (NBP2-55781).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Afadin/AF-6 Antibody (NBP2-55781) (0)

There are no reviews for Afadin/AF-6 Antibody (NBP2-55781). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Afadin/AF-6 Antibody (NBP2-55781) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Afadin/AF-6 Products

Bioinformatics Tool for Afadin/AF-6 Antibody (NBP2-55781)

Discover related pathways, diseases and genes to Afadin/AF-6 Antibody (NBP2-55781). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Afadin/AF-6 Antibody (NBP2-55781)

Discover more about diseases related to Afadin/AF-6 Antibody (NBP2-55781).

Pathways for Afadin/AF-6 Antibody (NBP2-55781)

View related products by pathway.

PTMs for Afadin/AF-6 Antibody (NBP2-55781)

Learn more about PTMs related to Afadin/AF-6 Antibody (NBP2-55781).

Blogs on Afadin/AF-6

There are no specific blogs for Afadin/AF-6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Afadin/AF-6 Antibody and receive a gift card or discount.


Gene Symbol MLLT4