Afadin/AF-6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Afadin/AF-6 Antibody [NBP1-90219] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cell junctions.
Immunohistochemistry-Paraffin: Afadin/AF-6 Antibody [NBP1-90219] - Staining of human pancreas shows distinct positivity in acinar luminal membranes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Afadin/AF-6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLLT4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Afadin/AF-6 Protein (NBP1-90219PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (87%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Afadin/AF-6 Antibody

  • AF6
  • AF-6
  • AF64
  • AFAD
  • Afadin
  • FLJ34371
  • MLLT4
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB600-248
Species: Hu
Applications: WB, IP
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF3064
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1566
Species: Hu
Applications: WB, IP
NBP1-90219
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Afadin/AF-6 Antibody (NBP1-90219) (0)

There are no publications for Afadin/AF-6 Antibody (NBP1-90219).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Afadin/AF-6 Antibody (NBP1-90219) (0)

There are no reviews for Afadin/AF-6 Antibody (NBP1-90219). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Afadin/AF-6 Antibody (NBP1-90219) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Afadin/AF-6 Products

Bioinformatics Tool for Afadin/AF-6 Antibody (NBP1-90219)

Discover related pathways, diseases and genes to Afadin/AF-6 Antibody (NBP1-90219). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Afadin/AF-6 Antibody (NBP1-90219)

Discover more about diseases related to Afadin/AF-6 Antibody (NBP1-90219).
 

Pathways for Afadin/AF-6 Antibody (NBP1-90219)

View related products by pathway.

PTMs for Afadin/AF-6 Antibody (NBP1-90219)

Learn more about PTMs related to Afadin/AF-6 Antibody (NBP1-90219).

Blogs on Afadin/AF-6

There are no specific blogs for Afadin/AF-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Afadin/AF-6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLLT4
Entrez
Uniprot