AF9 Antibody

Images

 
Western Blot: AF9 Antibody [NBP1-90217] - Analysis in human cell line HELA.
Immunocytochemistry/ Immunofluorescence: AF9 Antibody [NBP1-90217] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: AF9 Antibody [NBP1-90217] - Staining of human cerebellum shows strong nuclear positivity in purkinje cells.
Immunocytochemistry/ Immunofluorescence: AF9 Antibody [NBP1-90217] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AF9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLLT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AF9 Protein (NBP1-90217PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AF9 Antibody

  • AF-9
  • AF9myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 3
  • ALL1-fused gene from chromosome 9 protein
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocatedto, 3
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 3
  • Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein
  • protein AF-9
  • YEATS domain-containing protein 3
  • YEATS3FLJ2035

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-248
Species: Hu
Applications: WB, IP
NBP1-84840
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-28728
Species: Hu
Applications: IP (-), WB, IHC
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-40845
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
NB100-2628
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-89222
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF7829
Species: Hu
Applications: WB, IHC, ICC
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-74357
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027125-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF5414
Species: Hu
Applications: WB, Simple Western
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-90217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AF9 Antibody (NBP1-90217) (0)

There are no publications for AF9 Antibody (NBP1-90217).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AF9 Antibody (NBP1-90217) (0)

There are no reviews for AF9 Antibody (NBP1-90217). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AF9 Antibody (NBP1-90217) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AF9 Products

Bioinformatics Tool for AF9 Antibody (NBP1-90217)

Discover related pathways, diseases and genes to AF9 Antibody (NBP1-90217). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AF9 Antibody (NBP1-90217)

Discover more about diseases related to AF9 Antibody (NBP1-90217).
 

Pathways for AF9 Antibody (NBP1-90217)

View related products by pathway.

PTMs for AF9 Antibody (NBP1-90217)

Learn more about PTMs related to AF9 Antibody (NBP1-90217).
 

Research Areas for AF9 Antibody (NBP1-90217)

Find related products by research area.

Blogs on AF9

There are no specific blogs for AF9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AF9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLLT3