AF9 Antibody

Images

 
Genetic Strategies: Western Blot: AF9 Antibody [NBP1-90217] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1, using Anti-MLLT3 antibody. Remaining relative intensity is ...read more
Western Blot: AF9 Antibody [NBP1-90217] - Analysis in human cell line HEL.
Immunocytochemistry/ Immunofluorescence: AF9 Antibody [NBP1-90217] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AF9 Antibody [NBP1-90217] - Staining of human tonsil shows moderate to strong nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: AF9 Antibody [NBP1-90217] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: AF9 Antibody [NBP1-90217] - Staining of human colon shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: AF9 Antibody [NBP1-90217] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

AF9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLR
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLLT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AF9 Protein (NBP1-90217PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AF9 Antibody

  • AF-9
  • AF9myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 3
  • ALL1-fused gene from chromosome 9 protein
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocatedto, 3
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 3
  • Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein
  • protein AF-9
  • YEATS domain-containing protein 3
  • YEATS3FLJ2035

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004298-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-28728
Species: Hu
Applications: IHC, IHC-P, IP (-), WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-52105
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13754
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-40845
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IHC, IHC-P, IP, KD, WB
NBP1-90222
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-82991
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89222
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF7829
Species: Hu
Applications: ICC, IHC, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF5129
Species: Hu
Applications: WB
NB100-74357
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00027125-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NBP2-67811
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB

Publications for AF9 Antibody (NBP1-90217) (0)

There are no publications for AF9 Antibody (NBP1-90217).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AF9 Antibody (NBP1-90217) (0)

There are no reviews for AF9 Antibody (NBP1-90217). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AF9 Antibody (NBP1-90217) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AF9 Products

Bioinformatics Tool for AF9 Antibody (NBP1-90217)

Discover related pathways, diseases and genes to AF9 Antibody (NBP1-90217). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AF9 Antibody (NBP1-90217)

Discover more about diseases related to AF9 Antibody (NBP1-90217).
 

Pathways for AF9 Antibody (NBP1-90217)

View related products by pathway.

PTMs for AF9 Antibody (NBP1-90217)

Learn more about PTMs related to AF9 Antibody (NBP1-90217).
 

Research Areas for AF9 Antibody (NBP1-90217)

Find related products by research area.

Blogs on AF9

There are no specific blogs for AF9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AF9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLLT3