Adrenomedullin R/ADMR/GPR182 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GPR182 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Adrenomedullin R/ADMR/GPR182 Antibody - BSA Free
Background
G Protein-Coupled Receptor L1/G10D has been suggested to be an Adrenomedullin Receptor. Originally cloned from rats and later from humans, L1/G10D does not to bind adrenomedullin or display functional cAMP response to adrenomedullin (reviewed in Poyner et al. 2002). The initial experimental results, which demonstrated high-affinity binding and increased levels of cAMP in COS cells that were transfected with L1/G10D and treated with adrenomedullin, could not be reproduced by other laboratories (Kapas et al. 1995). It is now known that the functional adrenomedullin receptor is a heterodimeric complex composed of calcitonin receptor-like receptor (CRLR) and receptor activity modifying proteins (RAMPs) (McLatchie et al. 1998). L1/G10D therefore should be considered an Orphan A receptor. L1/G10D expression has been reported in adrenal gland, bone marrow, brain, heart, kidney, liver, lung, lymph node, pancreas, skeletal muscle, small intestine, spleen, stomach, testis, and thyroid. ESTs have been isolated from kidney, liver/spleen, fetal lung/testis/B-cell, and melanocyte/uterus/fetal heart libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, KO
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231) (0)
There are no publications for Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231) (0)
There are no reviews for Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Adrenomedullin R/ADMR/GPR182 Products
Research Areas for Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231)
Find related products by research area.
|
Blogs on Adrenomedullin R/ADMR/GPR182