Adrenomedullin R/ADMR/GPR182 Antibody

Images

 
Western Blot: Adrenomedullin R/ADMR/GPR182 Antibody [NBP1-90231] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-20
Immunohistochemistry-Paraffin: Adrenomedullin R/ADMR/GPR182 Antibody [NBP1-90231] - Staining of human heart muscle shows strong positivity of intercalated discs.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Adrenomedullin R/ADMR/GPR182 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR182
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Adrenomedullin R/ADMR/GPR182 Protein (NBP1-90231PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Adrenomedullin R/ADMR/GPR182 Antibody

  • 7TMR
  • ADMR
  • Adrenomedullin R
  • adrenomedullin receptor
  • AdrenomedullinR
  • AMR
  • AM-R
  • G protein-coupled receptor 182,7TMR
  • G10D
  • GAMRH
  • Gpcr22
  • GPR182
  • G-protein coupled receptor 182
  • hrhAMR
  • MB10
  • MGC34399
  • NOW

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
AF6108
Species: Hu
Applications: IHC
NBP2-01853
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF6428
Species: Hu
Applications: WB, IHC
AF4875
Species: Hu
Applications: WB
NB100-40840
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
AF6517
Species: Hu
Applications: WB
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33050
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58023
Species: Hu
Applications: WB
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-90231
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231) (0)

There are no publications for Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231) (0)

There are no reviews for Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adrenomedullin R/ADMR/GPR182 Products

Bioinformatics Tool for Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231)

Discover related pathways, diseases and genes to Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Adrenomedullin R/ADMR/GPR182 Antibody (NBP1-90231)

Find related products by research area.

Blogs on Adrenomedullin R/ADMR/GPR182

There are no specific blogs for Adrenomedullin R/ADMR/GPR182, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adrenomedullin R/ADMR/GPR182 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR182
Entrez