Adrenomedullin R/ADMR/GPR182 Antibody - BSA Free

Analysis in human spleen and cerebral cortex tissues using Anti-GPR182 antibody. Corresponding GPR182 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Adrenomedullin R/ADMR/GPR182 Antibody [NBP1-90231] - Staining of human spleen shows high expression.

Immunohistochemistry-Paraffin: Adrenomedullin R/ADMR/GPR182 Antibody [NBP1-90231] - Staining of human cerebral cortex shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Adrenomedullin R/ADMR/GPR182 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Adrenomedullin R/ADMR/GPR182 Antibody - BSA Free (NBP1-90231) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR182
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Adrenomedullin R/ADMR/GPR182 Protein (NBP1-90231PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Adrenomedullin R/ADMR/GPR182 Antibody - BSA Free

• 7TMR
• ADMR
• Adrenomedullin R
• adrenomedullin receptor
• AdrenomedullinR
• AMR
• AM-R
• G protein-coupled receptor 182,7TMR
• G10D
• GAMRH
• Gpcr22
• GPR182
• G-protein coupled receptor 182
• hrhAMR
• MB10
• MGC34399
• NOW

Background

G Protein-Coupled Receptor L1/G10D has been suggested to be an Adrenomedullin Receptor. Originally cloned from rats and later from humans, L1/G10D does not to bind adrenomedullin or display functional cAMP response to adrenomedullin (reviewed in Poyner et al. 2002). The initial experimental results, which demonstrated high-affinity binding and increased levels of cAMP in COS cells that were transfected with L1/G10D and treated with adrenomedullin, could not be reproduced by other laboratories (Kapas et al. 1995). It is now known that the functional adrenomedullin receptor is a heterodimeric complex composed of calcitonin receptor-like receptor (CRLR) and receptor activity modifying proteins (RAMPs) (McLatchie et al. 1998). L1/G10D therefore should be considered an Orphan A receptor. L1/G10D expression has been reported in adrenal gland, bone marrow, brain, heart, kidney, liver, lung, lymph node, pancreas, skeletal muscle, small intestine, spleen, stomach, testis, and thyroid. ESTs have been isolated from kidney, liver/spleen, fetal lung/testis/B-cell, and melanocyte/uterus/fetal heart libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR182