LYPD4 Antibody

Images

 
Western Blot: LYPD4 Antibody [NBP1-58023] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LYPD4 Antibody Summary

Immunogen
Synthetic peptides corresponding to LYPD4(LY6/PLAUR domain containing 4) The peptide sequence was selected from the N terminal of LYPD4. Peptide sequence MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LYPD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against LYPD4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LYPD4 Antibody

  • LY6/PLAUR domain containing 4
  • ly6/PLAUR domain-containing protein 4
  • LYPD4
  • MGC42718
  • SMR
  • sperm membrane receptor

Background

The specific function of LYPD4 is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47289
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-02332
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-26116
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP2-32005
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
236-EG
Species: Hu
Applications: BA
AF2535
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
H00004810-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-58023
Species: Hu
Applications: WB

Publications for LYPD4 Antibody (NBP1-58023) (0)

There are no publications for LYPD4 Antibody (NBP1-58023).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYPD4 Antibody (NBP1-58023) (0)

There are no reviews for LYPD4 Antibody (NBP1-58023). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYPD4 Antibody (NBP1-58023) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LYPD4 Products

Array NBP1-58023

Bioinformatics Tool for LYPD4 Antibody (NBP1-58023)

Discover related pathways, diseases and genes to LYPD4 Antibody (NBP1-58023). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LYPD4

There are no specific blogs for LYPD4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYPD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYPD4
Uniprot