Adrenomedullin/ADM Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADM |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Adrenomedullin/ADM Antibody - BSA Free
Background
Adrenomedullin is a member of the calcitonin family of peptides and functions as a vasodilator. Adrenomedullin, a hypotensive peptide, consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the calcitonin gene related peptide. Human adrenomedullin mRNA was found to be highly expressed in several tissues. Adrenomedullain is secreted from a number of tissues including the adrenal medulla, endothelial and vascular smooth muscle cells. It has been implicated in a number of diseases including cardiovascular and renal disorders, sepsis, inflammation, diabetes and cancer.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Publications for Adrenomedullin/ADM Antibody (NBP3-17681) (0)
There are no publications for Adrenomedullin/ADM Antibody (NBP3-17681).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Adrenomedullin/ADM Antibody (NBP3-17681) (0)
There are no reviews for Adrenomedullin/ADM Antibody (NBP3-17681).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Adrenomedullin/ADM Antibody (NBP3-17681) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Adrenomedullin/ADM Products
Research Areas for Adrenomedullin/ADM Antibody (NBP3-17681)
Find related products by research area.
|
Blogs on Adrenomedullin/ADM