AdipoR2 Antibody - BSA Free

Immunohistochemistry-Paraffin: AdipoR2 Antibody [NBP1-91652] - Staining of human Skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: AdipoR2 Antibody [NBP1-91652] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: AdipoR2 Antibody [NBP1-91652] - Staining of human Heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: AdipoR2 Antibody [NBP1-91652] - Staining of human Placenta shows strong cytoplasmic positivity in decidual cells.

Immunohistochemistry-Paraffin: AdipoR2 Antibody [NBP1-91652] - Staining of human Small intestine shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AdipoR2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AdipoR2 Antibody - BSA Free (NBP1-91652) is a polyclonal antibody validated for use in IHC. Anti-AdipoR2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADIPOR2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:10-1:20
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  AdipoR2 Protein (NBP1-91652PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25337209).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AdipoR2 Antibody - BSA Free

• ACDCR2
• adiponectin receptor 2
• adiponectin receptor protein 2
• AdipoR2
• FLJ21432
• PAQR2
• PAQR2MGC4640
• Progestin and adipoQ receptor family member II

Background

Adiponectin Receptor 2 is the receptor for globular and full length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AdipoR2 Antibody (NBP1-91652)(1)

Publication using NBP1-91652

• Guan G, Zhang D, Zheng Y et al. microRNA-423-3p promotes tumor progression via modulation of AdipoR2 in laryngeal carcinoma. Int J Clin Exp Pathol 2014-01-01 [PMID: 25337209] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: ADIPOR2