New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » ADE2 » ADE2 Antibodies » ADE2 Antibody (4F4)

ADE2 Antibody (4F4)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ADE2 Antibody (4F4) [H00010606-M01] - PAICS monoclonal antibody (M01), clone 4F4. Analysis of PAICS expression in human placenta.
Western Blot: ADE2 Antibody (4F4) [H00010606-M01] - PAICS monoclonal antibody (M01), clone 4F4. Analysis of PAICS expression in human placenta.
Sandwich ELISA: ADE2 Antibody (4F4) [H00010606-M01] - Detection limit for recombinant GST tagged PAICS is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ADE2 Antibody (4F4) Summary

Immunogen
PAICS (AAH10273, 1 a.a. ~ 425 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL
Specificity
PAICS (4F4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAICS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADE2 Antibody (4F4)

  • ADE2
  • AIR carboxylase
  • AIRCADE2H1
  • DKFZp781N1372
  • MGC1343
  • MGC5024
  • multifunctional protein ADE2
  • PAIS
  • phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazolesuccinocarboxamide synthetase
  • SAICAR synthetase

Background

This gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. The gene is closely linked and divergently transcribed with a locus that encodes an enzyme in the same pathway, and transcription of the two genes is coordinately regulated. The human genome contains several pseudogenes of this gene. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Phosphoribosyl
Pyrophosphate Amidotr ...
NBP2-02056
Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody (1B8) [NBP2-02056] Analysis of extracts (35ug) from 9 different cell lines by usin g anti-Phosphoribosyl Pyrophosphate Amidotransferase monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry-Paraffin: Phosphoribosyl Pyrophosphate Amidotransferase Antibody (1B8) [NBP2-02056] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-Phosphoribosyl Pyrophosphate Amidotransferase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Phosphoribosyl Pyrophosphate Amidotransferase Antibody (1B8) [NBP2-02056] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Phosphoribosyl Pyrophosphate Amidotransferase mouse monoclonal antibody.
(1 Publication)
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKR1B1 Antibody
NBP1-89146
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Analysis in human adrenal gland and liver tissues. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Amphiregulin
[Biotin]
DY262
(1 Review)
(38 Publications)
Species: Hu
Applications: ELISA
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Recombinant Human
DLEU1 GST (N-Term) Pr ...
H00010301-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - CD8 alpha expression in mouse spleen tissue using anti-CD8 alpha antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of bone marrow tissue by single and multiple staining.
Immunohistochemistry-Frozen: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of mosue spleen sections. CD8+ lymphocytes are marked by brown labeling of the cell surface.
(3 Reviews)
(19 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Recombinant Human
DLEU2 GST (N-Term) Pr ...
H00008847-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
CD8 beta Antibody
(BAT82A)
NBP2-60949
Flow Cytometry: CD8 beta Antibody (BAT82A) [NBP2-60949] - Obtained with bovine leukocytes
Species: Ma, Bv, Gt, Sh, Ma-WB
Applications: Flow, IHC, IHC-Fr
GART Antibody
(4D6-1D5)
H00002618-M01
Western Blot: GART Antibody (4D6-1D5) [H00002618-M01] - Analysis of GART expression in transfected 293T cell line by GART monoclonal antibody (M01), clone 4D6-1D5.Lane 1: GART transfected lysate(46 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: GART Antibody (4D6-1D5) [H00002618-M01] - Analysis of monoclonal antibody to GART on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: GART Antibody (4D6-1D5) [H00002618-M01] - Analysis of monoclonal antibody to GART on formalin-fixed paraffin-embedded human endometrium tissue. Antibody concentration 2 ug/ml.
(9 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
TYRP1 Antibody
NBP1-88370
Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in control (vector only transfected HEK293T lysate) and TYRP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Analysis in human skin and cerebral cortex tissues. Corresponding TYRP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human endometrium shows no positivity in glandular cells as expected.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TRPC1 Antibody
NB100-98844
Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat brain at 1:500 dilution using Rabbit antibody to 2d extracellular loop of TRPC1: whole serum, DAPI counterstained appearing in blue.
Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat olfactory bulb at 1:500 dilution using Rabbit antibody to TRPC1: whole serum, DAPI counterstained appearing in blue.
Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat brain at 1:500 dilution using Rabbit antibody to 2d extracellular loop of TRPC1: whole serum, DAPI counterstained appearing in blue.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
RanBP2 Antibody
NB120-2938
Western Blot: RanBP2 Antibody [NB120-2938] - Effect of hypoxia on the interaction between HIF1alpha and BICD1. Co-immunoprecipitation of HIF1alpha, Dynein IC, Importin alpha3, RanBP2 with IgG and BICD1 antibodies were shown in left panel. Total protein expressions in lysate were shown in right panel. n = 3. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41418-018-0241-1) licensed under a CC-BY licence.
Immunohistochemistry: RanBP2 Antibody [NB120-2938] - Figure 1 illustrates immunohistochemical staining of RanBP2 in bovine retina using NB120-2938. Figure 2 illustrates Western blot detection of RanBP2 from human retinal extracts using NB120-2938.
Western Blot: RanBP2 Antibody [NB120-2938] - Analysis of human retinal extracts.
(2 Publications)
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
Trypsin 1/PRSS1
Antibody [Unconjugate
AF3848
Trypsin 1/PRSS1 was detected in immersion fixed paraffin-embedded sections of human pancreas using Mouse Anti-Human Trypsin 1/PRSS1 Monoclonal Antibody (Catalog # MAB3848) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to exocrine cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: IHC, IP, WB
SLURP1 Antibody
AF4479
SLURP1 was detected in immersion fixed paraffin-embedded sections of human skin using Sheep Anti-Human SLURP1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4479) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counter­stained with hematoxylin (blue). Specific staining was localized to keratinocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC
p63/TP73L Antibody
[Unconjugated]
AF1916
p63/TP73L was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p63/TP73L was detected in immersion fixed SCC-25 human tongue carcinoma cell line using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Reviews)
(7 Publications)
Species: Hu
Applications: ICC, IHC, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
RAD52 Antibody
NBP2-58116
Western Blot: RAD52 Antibody [NBP2-58116] - HCC1937 human breast cancer cells untreated (1) and treated with a PARP inhibitor for 96 h (2). Two RAD52 bands can be appreciated at around 55 kDa. Ponceau red staining is used as total protein loading control (below). Primary antibody dilution 1:500 (overnight, 4C, rotation). Image from verified customer review.
Immunocytochemistry/Immunofluorescence: RAD52 Antibody [NBP2-58116] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, KD, WB
RRAD Antibody
NBP2-27500
Western Blot: RRAD Antibody [NBP2-27500] - Panel A: Staining of HEK293 lysates overexpressing several HA-tagged Mouse GTPases, including Rrad (10 ug protein in RIPA buffer) with antibody at 0.5 ug/mL, and compared with an HA-specific antibody. Panel B: Staining of WT and KO lysates of Mouse Heart (100 ug protein in RIPA buffer) with antibody at 0.5 ug/mL. Primary incubation was 1 hour. Detected by chemiluminescence. Data provided by Prof. D Andres, University of Kentucky College of Medicine, USA.
(1 Publication)
Species: Mu
Applications: KO, PEP-ELISA, WB

Publications for ADE2 Antibody (H00010606-M01) (0)

There are no publications for ADE2 Antibody (H00010606-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADE2 Antibody (H00010606-M01) (0)

There are no reviews for ADE2 Antibody (H00010606-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADE2 Antibody (H00010606-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADE2 Products

Bioinformatics Tool for ADE2 Antibody (H00010606-M01)

Discover related pathways, diseases and genes to ADE2 Antibody (H00010606-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADE2 Antibody (H00010606-M01)

Discover more about diseases related to ADE2 Antibody (H00010606-M01).
 

Pathways for ADE2 Antibody (H00010606-M01)

View related products by pathway.

Research Areas for ADE2 Antibody (H00010606-M01)

Find related products by research area.

Blogs on ADE2

There are no specific blogs for ADE2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADE2 Antibody (4F4) and receive a gift card or discount.


Bioinformatics

Gene Symbol PAICS
Entrez
OMIM
Uniprot