Home » ADE2 » ADE2 Antibodies » ADE2 Antibody (4F4)

ADE2 Antibody (4F4)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ADE2 Antibody (4F4) [H00010606-M01] - PAICS monoclonal antibody (M01), clone 4F4. Analysis of PAICS expression in human placenta.
Western Blot: ADE2 Antibody (4F4) [H00010606-M01] - PAICS monoclonal antibody (M01), clone 4F4. Analysis of PAICS expression in human placenta.
Sandwich ELISA: ADE2 Antibody (4F4) [H00010606-M01] - Detection limit for recombinant GST tagged PAICS is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ADE2 Antibody (4F4) Summary

Immunogen
PAICS (AAH10273, 1 a.a. ~ 425 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL
Specificity
PAICS (4F4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAICS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADE2 Antibody (4F4)

  • ADE2
  • AIR carboxylase
  • AIRCADE2H1
  • DKFZp781N1372
  • MGC1343
  • MGC5024
  • multifunctional protein ADE2
  • PAIS
  • phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazolesuccinocarboxamide synthetase
  • SAICAR synthetase

Background

This gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. The gene is closely linked and divergently transcribed with a locus that encodes an enzyme in the same pathway, and transcription of the two genes is coordinately regulated. The human genome contains several pseudogenes of this gene. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(13 Publications)
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
Phosphoribosyl
Pyrophosphate Amidotr ...
NBP2-02056
Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody (1B8) [NBP2-02056] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Phosphoribosyl Pyrophosphate Amidotransferase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Phosphoribosyl Pyrophosphate Amidotransferase.
Immunohistochemistry-Paraffin: Phosphoribosyl Pyrophosphate Amidotransferase Antibody (1B8) [NBP2-02056] - Staining of paraffin-embedded Human liver tissue using anti-Phosphoribosyl Pyrophosphate Amidotransferase mouse monoclonal antibody.
Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody (1B8) [NBP2-02056] Analysis of extracts (35ug) from 9 different cell lines by usin g anti-Phosphoribosyl Pyrophosphate Amidotransferase monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
(1 Publication)
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human cell line U-2 OS shows positivity in mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining in human adrenal gland and lymph node tissues using NBP2-38530 antibody. Corresponding FDXR RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AKR1B1 Antibody
NBP1-89146
Immunocytochemistry/Immunofluorescence: AKR1B1 Antibody [NBP1-89146] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Amphiregulin [HRP]
DAR00
(6 Reviews)
(9 Publications)
Species: Hu
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
DLEU1 Antibody
26660002
Immunohistochemistry: DLEU1 Antibody [26660002] - Weak to moderate cytoplasmic and nuclear positivity was seen in most normal tissues. Cells of cervix,uterine and spleen were negative. A similar staining pattern was also seen in most malignant tissues, weak to moderate cytoplasmic and occasional nuclear positivity. Image and statement courtesy of the Human Protein Atlas (HPA).
ELISA: DLEU1 Antibody [26660002] - Affinity Purified
(2 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P
CD8 Antibody
(53-6.7)
NBP1-49045
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/mL and incubated for 3 hours at room temperature.
Immunohistochemistry: CD8 Antibody (53-6.7) [NBP1-49045] - Histopathological analysis of spinal cord in EAE mice. Representative spinal cord sections from wild-type (WT), Asic1-/-, and Asic2-/- mice at 45 days after immunization. Sections of the spinal cord anterior horn were stained with hematoxylin and eosin (E&H) to assess inflammation and immunostained for MCHII, CD4+, CD8+ infiltrating cells. Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1111/ejn.14302), licensed under a CC-BY licence.
Flow Cytometry: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.
(2 Reviews)
(16 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Recombinant Human
DLEU2 GST (N-Term) Pr ...
H00008847-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
CD8 beta Antibody
(BAT82A)
NBP2-60949
Flow Cytometry: CD8 beta Antibody (BAT82A) [NBP2-60949] - Obtained with bovine leukocytes
Species: Ma, Bv, Gt, Sh, Ma-WB
Applications: Flow, IHC, IHC-Fr
GART Antibody
(4D6-1D5)
H00002618-M01
Western Blot: GART Antibody (4D6-1D5) [H00002618-M01] - Analysis of GART expression in transfected 293T cell line by GART monoclonal antibody (M01), clone 4D6-1D5.Lane 1: GART transfected lysate(46 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: GART Antibody (4D6-1D5) [H00002618-M01] - Analysis of monoclonal antibody to GART on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: GART Antibody (4D6-1D5) [H00002618-M01] - Analysis of monoclonal antibody to GART on formalin-fixed paraffin-embedded human endometrium tissue. Antibody concentration 2 ug/ml.
(9 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
TYRP1 Antibody
NBP1-88370
Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in control (vector only transfected HEK293T lysate) and TYRP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: TYRP1 Antibody [NBP1-88370] - Staining of human cell line SK-MEL-30 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human cerebral cortex shows no positivity in neurons as expected.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
TRPC1 Antibody
NB100-98844
Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat trigeminal at 1 : 500 dilution using Rabbit antibody to 2d extracellular loop of TRPC1: whole serum, DAPI counterstained appearing in blue.
Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat brain at 1:500 dilution using Rabbit antibody to 2d extracellular loop of TRPC1: whole serum, DAPI counterstained appearing in blue.
Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat olfactory bulb at 1:500 dilution using Rabbit antibody to TRPC1: whole serum, DAPI counterstained appearing in blue.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
RanBP2 Antibody
NB120-2938
Western Blot: RanBP2 Antibody [NB120-2938] - Effect of hypoxia on the interaction between HIF1alpha and BICD1. Co-immunoprecipitation of HIF1alpha, Dynein IC, Importin alpha3, RanBP2 with IgG and BICD1 antibodies were shown in left panel. Total protein expressions in lysate were shown in right panel. n = 3. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41418-018-0241-1) licensed under a CC-BY licence.
Immunohistochemistry: RanBP2 Antibody [NB120-2938] - Figure 1 illustrates immunohistochemical staining of RanBP2 in bovine retina using NB120-2938. Figure 2 illustrates Western blot detection of RanBP2 from human retinal extracts using NB120-2938.
Western Blot: RanBP2 Antibody [NB120-2938] - Analysis of human retinal extracts.
(2 Publications)
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
Trypsin 1/PRSS1
Antibody [Unconjugate
AF3848
Trypsin 1/PRSS1 was detected in immersion fixed paraffin-embedded sections of human pancreas using Mouse Anti-Human Trypsin 1/PRSS1 Monoclonal Antibody (Catalog # MAB3848) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to exocrine cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, IHC, IP
SLURP1 Antibody
AF4479
SLURP1 was detected in immersion fixed paraffin-embedded sections of human skin using Sheep Anti-Human SLURP1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4479) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counter­stained with hematoxylin (blue). Specific staining was localized to keratinocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC
p63/TP73L Antibody
[Unconjugated]
AF1916
p63/TP73L was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p63/TP73L was detected in immersion fixed SCC-25 human tongue carcinoma cell line using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Reviews)
(3 Publications)
Species: Hu
Applications: WB, IHC, ICC
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining in human adrenal gland and liver tissues using anti-QPCT antibody. Corresponding QPCT RNA-seq data are presented for the same tissues.
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in control (vector only transfected HEK293T lysate) and QPCT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
RAD52 Antibody
NBP2-58116
Immunocytochemistry/Immunofluorescence: RAD52 Antibody [NBP2-58116] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, PLA, KD
RRAD Antibody
NBP2-13266
Immunocytochemistry/Immunofluorescence: RRAD Antibody [NBP2-13266] - Staining of human cell line A549 shows localization to nucleoplasm, plasma membrane & the Golgi apparatus.
Immunohistochemistry-Paraffin: RRAD Antibody [NBP2-13266] - Staining of human heart muscle shows moderate membranous positivity in myocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ADE2 Antibody (H00010606-M01) (0)

There are no publications for ADE2 Antibody (H00010606-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADE2 Antibody (H00010606-M01) (0)

There are no reviews for ADE2 Antibody (H00010606-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADE2 Antibody (H00010606-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ADE2 Products

Bioinformatics Tool for ADE2 Antibody (H00010606-M01)

Discover related pathways, diseases and genes to ADE2 Antibody (H00010606-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADE2 Antibody (H00010606-M01)

Discover more about diseases related to ADE2 Antibody (H00010606-M01).
 

Pathways for ADE2 Antibody (H00010606-M01)

View related products by pathway.

Research Areas for ADE2 Antibody (H00010606-M01)

Find related products by research area.

Blogs on ADE2

There are no specific blogs for ADE2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADE2 Antibody (4F4) and receive a gift card or discount.


Bioinformatics

Gene Symbol PAICS
Entrez
OMIM
Uniprot