ADAM12 Antibody


Western Blot: ADAM12 Antibody [NBP2-33939] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP2-33939] - Staining of human smooth muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP2-33939] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP2-33939] - Staining of human placenta shows moderate to strong positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP2-33939] - Staining in human placenta and pancreas tissues. Corresponding ADAM12 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ADAM12 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RGVSLWNQGRADEVVSASVRSGDLWIPVKSFDSKNHPEVLNIRLQRESKELIINLERNEGLIASSFT
Specificity of human ADAM12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ADAM12 Protein (NBP2-33939PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ADAM12 Antibody

  • a disintegrin and metalloproteinase domain 12 (meltrin alpha)
  • ADAM 12
  • ADAM metallopeptidase domain 12
  • ADAM12
  • disintegrin and metalloproteinase domain-containing protein 12
  • EC 3.4.24
  • EC
  • MCMP
  • MCMPMltna
  • Meltrin alpha
  • meltrin-alpha
  • MLTNEC 3.4.24.-


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready
Species: Hu
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PAGE
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, IP, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ADAM12 Antibody (NBP2-33939) (0)

There are no publications for ADAM12 Antibody (NBP2-33939).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM12 Antibody (NBP2-33939) (0)

There are no reviews for ADAM12 Antibody (NBP2-33939). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAM12 Antibody (NBP2-33939) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ADAM12 Products

Bioinformatics Tool for ADAM12 Antibody (NBP2-33939)

Discover related pathways, diseases and genes to ADAM12 Antibody (NBP2-33939). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM12 Antibody (NBP2-33939)

Discover more about diseases related to ADAM12 Antibody (NBP2-33939).

Pathways for ADAM12 Antibody (NBP2-33939)

View related products by pathway.

PTMs for ADAM12 Antibody (NBP2-33939)

Learn more about PTMs related to ADAM12 Antibody (NBP2-33939).

Blogs on ADAM12

There are no specific blogs for ADAM12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ADAM12 Antibody and receive a gift card or discount.


Gene Symbol ADAM12