Western Blot: ADAM19 Antibody [NBP1-69364] - This Anti-ADAM19 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.
Western Blot: ADAM19 Antibody [NBP1-69364] - Analysis of ADAM19 in HeLa whole cell lyaste (30ug) using anti-ADAM19 antibody. Image from verified customer review.
Western Blot: ADAM19 Antibody [NBP1-69364] - ADAM10 is upregulated in experimental heart injury as well as patients w/ ischemic cardiomyopathy & correlates w/ ANP/ BNP expression.a WB analysis & b quantification of ...read more
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to ADAM19(ADAM metallopeptidase domain 19 (meltrin beta)) The peptide sequence was selected from the N terminal of ADAM19 (NP_075525). Peptide sequence VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG. The peptide sequence for this immunogen was taken from within the described region.
Marker
Dendritic Cell Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAM19
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunocytochemistry/Immunofluorescence and Immunohistochemistry were reported in scientific literature.
Theoretical MW
82 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5 using NBP1-69364 in the following applications:
Mouse reactivity reported in scientific literature (PMID: 22930161).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified
Alternate Names for ADAM19 Antibody - BSA Free
a disintegrin and metalloproteinase domain 19 (meltrin beta)
ADAM 19
ADAM metallopeptidase domain 19
ADAM19
disintegrin and metalloproteinase domain-containing protein 19
EC 3.4.24
EC 3.4.24.-
MADDAM
Meltrin beta
Meltrin-beta
Metalloprotease and disintegrin dendritic antigen marker
MLTNBmeltrin beta
Background
ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.