ADAM19 Antibody


Western Blot: ADAM19 Antibody [NBP1-69364] - This Anti-ADAM19 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.
Western Blot: ADAM19 Antibody [NBP1-69364] - Analysis of ADAM19 in HeLa whole cell lyaste (30ug) using anti-ADAM19 antibody. Image from verified customer review.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC

Order Details

ADAM19 Antibody Summary

Synthetic peptides corresponding to ADAM19(ADAM metallopeptidase domain 19 (meltrin beta)) The peptide sequence was selected from the N terminal of ADAM19 (NP_075525). Peptide sequence VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG.
Dendritic Cell Marker
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ADAM19 and was validated on Western blot. Immunocytochemistry/Immunofluorescence and Immunohistochemistry were reported in scientific literature.
Theoretical MW
82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
NBP1-69364 in the following applications:

Read Publications using
NBP1-69364 in the following applications:

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ADAM19 Antibody

  • a disintegrin and metalloproteinase domain 19 (meltrin beta)
  • ADAM 19
  • ADAM metallopeptidase domain 19
  • ADAM19
  • disintegrin and metalloproteinase domain-containing protein 19
  • EC 3.4.24
  • EC 3.4.24.-
  • Meltrin beta
  • meltrin-beta
  • Metalloprotease and disintegrin dendritic antigen marker
  • MLTNBmeltrin beta


ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP

Publications for ADAM19 Antibody (NBP1-69364)(3)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: ICC/IF, IHC.

Filter By Application
All Applications
Filter By Species
All Species

Review for ADAM19 Antibody (NBP1-69364) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-69364:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot ADAM19 NBP1-69364
reviewed by:
WB Human 10/06/2014


ApplicationWestern Blot
Sample TestedWhole cell lysate from HeLa cells


Blocking Details5% NFDM in PBS+0.1% Triton

Primary Anitbody

Dilution Ratio1000 times diluted in PBS, incubated for 2 hours at room temperature

Secondary Antibody

Secondary DescriptionAnti-rabbit IgG, HRP-linked Antibody (Cell Signaling)
Secondary Manufacturer Cat##7074
Secondary Concentration20,000


Detection NotesCaptured using X-rays (30 sec exposure) with Phototope-HRP Western Blot Detection System

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADAM19 Antibody (NBP1-69364) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ADAM19 Antibody (NBP1-69364)

Discover related pathways, diseases and genes to ADAM19 Antibody (NBP1-69364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM19 Antibody (NBP1-69364)

Discover more about diseases related to ADAM19 Antibody (NBP1-69364).

Pathways for ADAM19 Antibody (NBP1-69364)

View related products by pathway.

PTMs for ADAM19 Antibody (NBP1-69364)

Learn more about PTMs related to ADAM19 Antibody (NBP1-69364).

Research Areas for ADAM19 Antibody (NBP1-69364)

Find related products by research area.

Blogs on ADAM19

There are no specific blogs for ADAM19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Human


Gene Symbol ADAM19