ADAM12 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ADAM12 Antibody [NBP1-82791] - Staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP1-82791] - Staining of human placenta shows moderate positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP1-82791] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAM12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAM12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADAM12 Protein (NBP1-82791PEP)
Publications
Read Publication using NBP1-82791.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23631827)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAM12 Antibody

  • a disintegrin and metalloproteinase domain 12 (meltrin alpha)
  • ADAM 12
  • ADAM metallopeptidase domain 12
  • ADAM12
  • disintegrin and metalloproteinase domain-containing protein 12
  • EC 3.4.24
  • EC 3.4.24.58
  • MCMP
  • MCMPMltna
  • Meltrin alpha
  • meltrin-alpha
  • MLTNA
  • MLTNEC 3.4.24.-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF949
Species: Hu, Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready
930-ADB
Species: Hu
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-53210
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PAGE
AF2487
Species: Hu
Applications: WB, IP
NBP1-69364
Species: Hu
Applications: WB, ICC/IF, IHC
MAB935
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
AF1031
Species: Hu
Applications: WB, IP, ICC
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP2-55995
Species: Hu
Applications: ICC/IF
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-82791
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ADAM12 Antibody (NBP1-82791)(1)

Reviews for ADAM12 Antibody (NBP1-82791) (0)

There are no reviews for ADAM12 Antibody (NBP1-82791). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAM12 Antibody (NBP1-82791) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAM12 Products

Bioinformatics Tool for ADAM12 Antibody (NBP1-82791)

Discover related pathways, diseases and genes to ADAM12 Antibody (NBP1-82791). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM12 Antibody (NBP1-82791)

Discover more about diseases related to ADAM12 Antibody (NBP1-82791).
 

Pathways for ADAM12 Antibody (NBP1-82791)

View related products by pathway.

PTMs for ADAM12 Antibody (NBP1-82791)

Learn more about PTMs related to ADAM12 Antibody (NBP1-82791).

Blogs on ADAM12

There are no specific blogs for ADAM12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAM12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM12
Entrez