ACY3 Antibody

Images

 
Western Blot: ACY3 Antibody [NBP1-89256] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: ACY3 Antibody [NBP1-89256] - Staining of human cell line A-431 shows positivity in vesicles.
Immunohistochemistry-Paraffin: ACY3 Antibody [NBP1-89256] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACY3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NTTANMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACY3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ACY3 Protein (NBP1-89256PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACY3 Antibody

  • ACY-3aspartoacylase-2
  • Acylase III
  • aminoacylase-3
  • aspartoacylase (aminocyclase) 3
  • EC 3.5.1.-
  • EC 3.5.1.15
  • HCBP1ASPA2
  • Hepatitis C virus core-binding protein 1
  • MGC9740

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00970
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-31754
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-81427
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-30010
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83670
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-89857
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32462
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000034-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-89256
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACY3 Antibody (NBP1-89256) (0)

There are no publications for ACY3 Antibody (NBP1-89256).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACY3 Antibody (NBP1-89256) (0)

There are no reviews for ACY3 Antibody (NBP1-89256). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACY3 Antibody (NBP1-89256) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACY3 Products

Bioinformatics Tool for ACY3 Antibody (NBP1-89256)

Discover related pathways, diseases and genes to ACY3 Antibody (NBP1-89256). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACY3 Antibody (NBP1-89256)

Discover more about diseases related to ACY3 Antibody (NBP1-89256).
 

Pathways for ACY3 Antibody (NBP1-89256)

View related products by pathway.

Research Areas for ACY3 Antibody (NBP1-89256)

Find related products by research area.

Blogs on ACY3

There are no specific blogs for ACY3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACY3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACY3
Entrez
Uniprot