ACTL6B Antibody

Images

 
Western Blot: ACTL6B Antibody [NBP1-55478] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACTL6B Antibody Summary

Immunogen
Synthetic peptides corresponding to ACTL6B(actin-like 6B) The peptide sequence was selected from the middle region of ACTL6B. Peptide sequence GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTL6B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ACTL6B and was validated on Western blot.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACTL6B Antibody

  • 53 kDa BRG1-associated factor B
  • actin-like 6
  • actin-like 6B
  • Actin-related protein Baf53b
  • ACTL6
  • arpNalpha
  • BAF53Bactin-like protein 6B
  • BRG1-associated factor 53B
  • hArpN alpha

Background

The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feat

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-61628
Species: Hu, Mu
Applications: IP (-), WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19795
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13932
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61882
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NB100-757
Species: Hu
Applications: WB, IHC, IHC-P, ChIP
H00008815-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-90099
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
H00057180-B01P
Species: Hu
Applications: WB, ELISA
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13957
Species: Hu
Applications: WB, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP2-19016
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-55478
Species: Hu
Applications: WB

Publications for ACTL6B Antibody (NBP1-55478) (0)

There are no publications for ACTL6B Antibody (NBP1-55478).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTL6B Antibody (NBP1-55478) (0)

There are no reviews for ACTL6B Antibody (NBP1-55478). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACTL6B Antibody (NBP1-55478) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACTL6B Products

Bioinformatics Tool for ACTL6B Antibody (NBP1-55478)

Discover related pathways, diseases and genes to ACTL6B Antibody (NBP1-55478). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACTL6B Antibody (NBP1-55478)

Discover more about diseases related to ACTL6B Antibody (NBP1-55478).
 

Pathways for ACTL6B Antibody (NBP1-55478)

View related products by pathway.

Research Areas for ACTL6B Antibody (NBP1-55478)

Find related products by research area.

Blogs on ACTL6B

There are no specific blogs for ACTL6B, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTL6B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTL6B
Uniprot
COVID-19 update