Neuro D4 Antibody

Images

 
Western Blot: Neuro D4 Antibody [NBP2-13932] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: Neuro D4 Antibody [NBP2-13932] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Neuro D4 Antibody [NBP2-13932] - Staining of human cerebral cortex shows distinct nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Neuro D4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRR KNRAKGKAYGIGGLRKRQDTASLEDR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Neuro D4 Protein (NBP2-13932PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-13932 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neuro D4 Antibody

  • BAF45B
  • BRG1-associated factor 45B
  • D4, zinc and double PHD fingers family 1NEUD4BAF45b
  • MGC150428
  • MGC150429
  • neuro-d4 homolog
  • neuro-d4
  • zinc finger protein neuro-d4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87138
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14910
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19795
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP1-91648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61628
Species: Hu, Mu
Applications: IP (-), WB, Simple Western, ICC/IF, IHC, IHC-P, PLA
H00058158-B02P
Species: Hu
Applications: WB, ELISA
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-757
Species: Hu
Applications: WB, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2775
Species: Hu, Mu
Applications: WB
NBP2-43567
Species: Hu, Mu
Applications: WB
NBP1-88932
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057492-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP2-13932
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Neuro D4 Antibody (NBP2-13932) (0)

There are no publications for Neuro D4 Antibody (NBP2-13932).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Neuro D4 Antibody (NBP2-13932) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP2-13932:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Neuro D4 NBP2-13932
Enlarge
reviewed by:
Anonymous
WB Human 08/07/2014
View

Summary

ApplicationWestern Blot
Sample TestedBT16 Nuclear Extract
SpeciesHuman
LotR59130
CommentsThis antibody works great for detecting endogenous DPF1/Neuro D4 in human cancer cell line BT16

Blocking

Blocking Details10% Non-fat milk in PBST for30 min

Primary Anitbody

Dilution Ratio1:1000; Overnight at 4 degree; in 1% Non-fat milk in PBST

Secondary Antibody

Secondary DescriptionGoat anti-Rabbit IgG-HRP
Secondary Manufacturer Cat#Jackson ImmunoResearch Laboratories
Secondary Concentration1:5000

Details

Detection NotesECL; exposure time: 3 min

Comments

CommentsThis antibody works great for detecting endogenous DPF1/Neuro D4 in human cancer cell line BT16

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Neuro D4 Antibody (NBP2-13932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuro D4 Products

Bioinformatics Tool for Neuro D4 Antibody (NBP2-13932)

Discover related pathways, diseases and genes to Neuro D4 Antibody (NBP2-13932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuro D4 Antibody (NBP2-13932)

Discover more about diseases related to Neuro D4 Antibody (NBP2-13932).
 

Pathways for Neuro D4 Antibody (NBP2-13932)

View related products by pathway.

Research Areas for Neuro D4 Antibody (NBP2-13932)

Find related products by research area.

Blogs on Neuro D4

There are no specific blogs for Neuro D4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
08/07/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol DPF1