Neuro D4 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Neuro D4 Antibody [NBP2-13932] - Analysis in human cerebral cortex and cervix, uterine tissues using NBP2-13932 antibody. Corresponding DPF1 RNA-seq data are ...read more
Western Blot: Neuro D4 Antibody [NBP2-13932] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: Neuro D4 Antibody [NBP2-13932] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Neuro D4 Antibody [NBP2-13932] - Staining of human kidney shows no cytoplasmic positivity in cells in tubules and cells in glomeruli as expected.
Immunohistochemistry-Paraffin: Neuro D4 Antibody [NBP2-13932] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: Neuro D4 Antibody [NBP2-13932] - Staining of human cervix, uterine shows no cytoplasmic positivity in squamous epithelial cells as expected.
Immunohistochemistry-Paraffin: Neuro D4 Antibody [NBP2-13932] - Staining of human testis shows strong membranous positivity in spermatids and spermatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Neuro D4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: VLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQDTASLEDR
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Neuro D4 Protein (NBP2-13932PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-13932 in the following applications:

Publications
Read Publication using NBP2-13932.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neuro D4 Antibody

  • BAF45B
  • BRG1-associated factor 45B
  • D4, zinc and double PHD fingers family 1NEUD4BAF45b
  • MGC150428
  • MGC150429
  • neuro-d4 homolog
  • neuro-d4
  • zinc finger protein neuro-d4

Background

Conserved gene encoding a human 353 amino acid neural specific zinc finger protein which was designated neuro d4. A cysteine and histidine rich region of the C terminus distinguishes members of this family from other zinc finger proteins. The human and rat cDNAs are 93% identical and only 3 amino acid differences are observed between the proteins. Different alternatively spliced cDNAs can be observed. The gene has been mapped to chromosome 19 using chromosomal somatic cell hybrid panels.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Neuro D4 Antibody (NBP2-13932)(1)

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP2-13932 Applications Species
Baumann V Identification and manipulation of chromatin barriers in transcriptional reprogramming Thesis (ICC/IF) ICC/IF

Review for Neuro D4 Antibody (NBP2-13932) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-13932:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Neuro D4 NBP2-13932
Enlarge
4
reviewed by:
Verified Customer
WB Human 08/07/2014
View

Summary

ApplicationWestern Blot
Sample TestedBT16 Nuclear Extract
SpeciesHuman
LotR59130

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Neuro D4 Antibody (NBP2-13932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuro D4 Products

Research Areas for Neuro D4 Antibody (NBP2-13932)

Find related products by research area.

Blogs on Neuro D4

There are no specific blogs for Neuro D4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
08/07/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol DPF1