Neuro D4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Neuro D4 Antibody [NBP2-13932] - Analysis in human cerebral cortex and cervix, uterine tissues using NBP2-13932 antibody. Corresponding DPF1 RNA-seq data are presented for the same tissues.

Western Blot: Neuro D4 Antibody [NBP2-13932] - Analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: Neuro D4 Antibody [NBP2-13932] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Neuro D4 Antibody [NBP2-13932] - Staining of human kidney shows no cytoplasmic positivity in cells in tubules and cells in glomeruli as expected.

Immunohistochemistry-Paraffin: Neuro D4 Antibody [NBP2-13932] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: Neuro D4 Antibody [NBP2-13932] - Staining of human cervix, uterine shows no cytoplasmic positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: Neuro D4 Antibody [NBP2-13932] - Staining of human testis shows strong membranous positivity in spermatids and spermatocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Neuro D4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: VLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQDTASLEDR
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Neuro D4 Protein (NBP2-13932PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Neuro D4 Antibody - BSA Free

• BAF45B
• BRG1-associated factor 45B
• D4, zinc and double PHD fingers family 1NEUD4BAF45b
• MGC150428
• MGC150429
• neuro-d4 homolog
• neuro-d4
• zinc finger protein neuro-d4

Background

Conserved gene encoding a human 353 amino acid neural specific zinc finger protein which was designated neuro d4. A cysteine and histidine rich region of the C terminus distinguishes members of this family from other zinc finger proteins. The human and rat cDNAs are 93% identical and only 3 amino acid differences are observed between the proteins. Different alternatively spliced cDNAs can be observed. The gene has been mapped to chromosome 19 using chromosomal somatic cell hybrid panels.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Neuro D4 Antibody (NBP2-13932)(1)

Publication using NBP2-13932

• Baumann V Identification and manipulation of chromatin barriers in transcriptional reprogramming Thesis (ICC/IF)

Review for Neuro D4 Antibody (NBP2-13932) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 08/07/2014

Summary

• Application: Western Blot
• Sample Tested: BT16 Nuclear Extract
• Species: Human
• Lot: R59130

Bioinformatics

• Gene Symbol: DPF1