actin, gamma 2 Antibody

Images

 
Western Blot: actin, gamma 2 Antibody [H00000072-D01P] - Analysis of ACTG2 expression in transfected 293T cell line by ACTG2 polyclonal antibody.Lane 1: ACTG2 transfected lysate(41.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

actin, gamma 2 Antibody Summary

Immunogen
ACTG2 (NP_001606.1, 1 a.a. - 376 a.a.) full-length human protein. MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF
Specificity
ACTG2 - actin, gamma 2, smooth muscle, enteric,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTG2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00000072-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for actin, gamma 2 Antibody

  • ACT
  • ACTA3alpha-actin 3
  • ACTE
  • actin, gamma 2, smooth muscle, enteric
  • actin, gamma-enteric smooth muscle
  • ACTL3
  • ACTSGactin-like protein
  • alpha-actin-3
  • gamma-2-actin
  • smooth muscle gamma actin
  • Smooth muscle gamma-actin

Background

Actins are highly conserved proteins that are involved in various types of cell motility, and maintenance of the cytoskeleton. In vertebrates, three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. Actin, gamma 2, encoded by this gene, is a smooth muscle actin found in enteric tissues. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2898
Species: Mu
Applications: WB, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF1267
Species: Hu
Applications: WB, IP, Neut
7270-IL/CF
Species: Hu
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF5739
Species: Hu, Mu, Rt
Applications: WB
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47957
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P, IP
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00000072-D01P
Species: Hu
Applications: WB

Publications for actin, gamma 2 Antibody (H00000072-D01P)(1)

Reviews for actin, gamma 2 Antibody (H00000072-D01P) (0)

There are no reviews for actin, gamma 2 Antibody (H00000072-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for actin, gamma 2 Antibody (H00000072-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional actin, gamma 2 Products

Bioinformatics Tool for actin, gamma 2 Antibody (H00000072-D01P)

Discover related pathways, diseases and genes to actin, gamma 2 Antibody (H00000072-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for actin, gamma 2 Antibody (H00000072-D01P)

Discover more about diseases related to actin, gamma 2 Antibody (H00000072-D01P).
 

Pathways for actin, gamma 2 Antibody (H00000072-D01P)

View related products by pathway.

Blogs on actin, gamma 2

There are no specific blogs for actin, gamma 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our actin, gamma 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTG2
Entrez
Uniprot