Home » actin, gamma 2 » actin, gamma 2 Antibodies » actin, gamma 2 Antibody

actin, gamma 2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: actin, gamma 2 Antibody [H00000072-D01P] - Analysis of ACTG2 expression in transfected 293T cell line by ACTG2 polyclonal antibody.Lane 1: ACTG2 transfected lysate(41.90 KDa).Lane 2: Non-transfected lysate.
Western Blot: actin, gamma 2 Antibody [H00000072-D01P] - Analysis of ACTG2 expression in transfected 293T cell line by ACTG2 polyclonal antibody.Lane 1: ACTG2 transfected lysate(41.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

actin, gamma 2 Antibody Summary

Immunogen
ACTG2 (NP_001606.1, 1 a.a. - 376 a.a.) full-length human protein. MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF
Specificity
ACTG2 - actin, gamma 2, smooth muscle, enteric,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTG2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00000072-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for actin, gamma 2 Antibody

  • ACT
  • ACTA3alpha-actin 3
  • ACTE
  • actin, gamma 2, smooth muscle, enteric
  • actin, gamma-enteric smooth muscle
  • ACTL3
  • ACTSGactin-like protein
  • alpha-actin-3
  • gamma-2-actin
  • smooth muscle gamma actin
  • Smooth muscle gamma-actin

Background

Actins are highly conserved proteins that are involved in various types of cell motility, and maintenance of the cytoskeleton. In vertebrates, three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. Actin, gamma 2, encoded by this gene, is a smooth muscle actin found in enteric tissues. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Carboxypeptidase
B1/CPB1 Antibody
NBP2-15698
Western Blot: Carboxypeptidase B1/CPB1 Antibody [NBP2-15698] - Rat tissue extract (50 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Carboxypeptidase B antibody [N3C3] diluted at 1:50000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Carboxypeptidase B1/CPB1 Antibody [NBP2-15698] - Paraffin-embedded rat pancreas. Carboxypeptidase B antibody [N3C3] diluted at 1:1000.
Western Blot: Carboxypeptidase B1/CPB1 Antibody [NBP2-15698] - Mouse tissue extract (50 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Carboxypeptidase B antibody [N3C3] diluted at 1:50000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
Serpin A3/alpha
1-Antichymotrypsin An ...
NBP2-52559
Western Blot: Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) [NBP2-52559] - Analysis using SERPINA3 mAb against human SERPINA3 (AA: 279-432) recombinant protein. (Expected MW is 42.3 kDa)
Immunohistochemistry-Paraffin: Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) [NBP2-52559] - Analysis of paraffin-embedded bladder cancer tissues using SERPINA3 mouse mAb with DAB staining.
Flow Cytometry: Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) [NBP2-52559] - Analysis of A549 cells using SERPINA3 mouse mAb (green) and negative control (red).
(1 Publication)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Apolipoprotein
E/ApoE Antibody (WUE-
NB110-60531
Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE was detected in immersion fixed paraffin-embedded sections of human liver using anti-human mouse monoclonal antibody (Catalog # NB110-60531) at 1:200 dilution overnight at 4 C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
Western Blot: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Detection of ApoE in human tissue lysate using NB110-60531. Lane 1: liver Lane 2: brain
Flow Cytometry: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using ApoE antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Reviews)
(12 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Serpin
C1/Antithrombin-III A ...
MAB1287
Serpin C1/Antithrombin-III Antibody (208730)
(3 Publications)
Species: Mu
Applications: WB
IL-6 [Unconjugated]
7270-IL/CF
IL-6 [Unconjugated]
Species: Hu
PSAT1 Antibody
NBP1-32920
Western Blot: PSAT1 Antibody [NBP1-32920] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PSAT1 antibody [N1C3].
Immunocytochemistry/Immunofluorescence: PSAT1 Antibody [NBP1-32920] - Paraformaldehyde-fixed A549, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: PSAT1 Antibody [NBP1-32920] - Paraffin-embedded NCI-N87 xenograft, using antibody at 1:500 dilution.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Protein S/PROS1
Antibody
NBP1-87217
Western Blot: Protein S/PROS1 Antibody [NBP1-87217] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Protein S/PROS1 Antibody [NBP1-87217] - Staining of human epididymis shows positivity in plasma.
Western Blot: Protein S/PROS1 Antibody [NBP1-87217] - Analysis in human plasma.
Species: Hu, Mu
Applications: WB, IHC, IHC-P
PLAG1 Antibody
(3B7)
H00005324-M02
Western Blot: PLAG1 Antibody (3B7) [H00005324-M02] - Western Blot detection against Immunogen (36.52 KDa).
ELISA: PLAG1 Antibody (3B7) [H00005324-M02] - Detection limit for recombinant GST tagged PLAG1 is approximately 0.03ng/ml as a capture antibody.
(6 Publications)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Puromycin-sensitive am ...
6410-ZN
Puromycin-sensitive aminopeptidase/NPEPPS
(1 Publication)
Species: Hu
beta Amyloid
Antibody (MOAB-2)
NBP2-13075
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of beta Amyloid on normal mouse brain (left) and 5xFAD mouse brain (right) using DAB with hematoxylin counterstain. The MOAB-2 antibody was used at 1:20 on normal mouse brain and at 1:400 on 5xFAD mouse brain.
Immunohistochemistry-Paraffin: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of a formalin fixed paraffin embedded tissue section of human brain (Alzheimers disease, hippocampus) using 1:200 dilution of anti-beta Amyloid antibody (clone MOAB-2). The staining was developed with HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This beta Amyloid antibody specifically stained the cells with Abeta 42/ Abeta aggregates while the normal cells were negative for abeta peptide.
Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Western blot analysis in cell lysates from HEK-APP SWE/BACE1 cells probed with an antibody against the C-terminus of APP (Lanes 1 and 2) and beta Amyloid (MOAB-2, Lanes 3 and 4). Beta Amyloid (MOAB-2) does not detect APP (from PMID: 22423893).
(1 Review)
(12 Publications)
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
CSRP1 Antibody
AF5739
Western blot shows lysates of ME-180 human cervical epithelial carcinoma cell line, HT-2 mouse T cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL Goat Anti-Human/Mouse/Rat CSRP1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5739) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, recombinant human CSRP1, CSRP2, CSRP3 (5 ng/lane) were included. A specific band for CSRP1 was detected at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(21 Reviews)
(525 Publications)
Species: Hu
TFF2 Antibody
(366508) [Unconjugate
MAB4077
TFF2 was detected in immersion fixed paraffin-embedded sections of human stomach using Mouse Anti-Human TFF2 Monoclonal Antibody (Catalog # MAB4077) at 1.7 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to gastric glands. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Publication)
Species: Hu
Applications: WB, IHC
Serpin A5/Protein
C Inhibitor Antibody ...
NBP2-01833
Western Blot: Serpin A5/Protein C Inhibitor Antibody (2D10) [NBP2-01833] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Protein C inhibitor (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Protein C inhibitor.
Immunocytochemistry/Immunofluorescence: Serpin A5/Protein C Inhibitor Antibody (2D10) [NBP2-01833] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Protein C inhibitor.
Immunohistochemistry-Paraffin: Serpin A5/Protein C Inhibitor Antibody (2D10) [NBP2-01833] - Staining of paraffin-embedded Human tonsil using anti-Protein C inhibitor mouse monoclonal antibody.
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Serpin A1/alpha
1-Antitrypsin Antibod ...
NBP2-52557
Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody (5D1D2) [NBP2-52557] - Analysis using SERPINA1 mAb against HEK293 (1) and SERPINA1 (AA: 23-237)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: Serpin A1/alpha 1-Antitrypsin Antibody (5D1D2) [NBP2-52557] - Immunofluorescence analysis of GC-7901 cells using SERPINA1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody (5D1D2) [NBP2-52557] - Analysis of paraffin-embedded bladder cancer tissues using SERPINA1 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Presenilin-1
Antibody (APS 11)
NB300-749
Western Blot: Presenilin-1 Antibody (APS 11) [NB300-749] - Analysis of 25 ug of SH-SY5Y (lane 1), human brain (lane 2) and mouse brain (lane 3).
Immunocytochemistry/Immunofluorescence: Presenilin-1 Antibody (APS 11) [NB300-749] - Mouse fibroblasts.
Immunohistochemistry-Paraffin: Presenilin-1 Antibody (APS 11) [NB300-749] - Immunohistochemistry was performed on normal biopsies of deparaffinized Human liver tissue. To expose target proteins, heat induced antigen retrieval was performed using 10mM sodium citrate (pH6.0) buffer, microwaved for 8-15 minutes. Following antigen retrieval tissues were blocked in 3% BSA-PBS for 30 minutes at room temperature. Tissues were then probed at a dilution of 1:200 with a mouse monoclonal antibody recognizing Presenilin 1 or without primary antibody (negative control) overnight at 4C in a humidified chamber. Tissues were washed extensively with PBST and endogenous peroxidase activity was quenched with a peroxidase suppressor. Tissues were counterstained with hematoxylin and prepped for mounting.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
actin, gamma 2
Antibody
H00000072-D01P
actin, gamma 2 Antibody
Species: Hu
Applications: WB

Publications for actin, gamma 2 Antibody (H00000072-D01P)(1)


Reviews for actin, gamma 2 Antibody (H00000072-D01P) (0)

There are no reviews for actin, gamma 2 Antibody (H00000072-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for actin, gamma 2 Antibody (H00000072-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for actin, gamma 2 Antibody (H00000072-D01P)

Discover related pathways, diseases and genes to actin, gamma 2 Antibody (H00000072-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for actin, gamma 2 Antibody (H00000072-D01P)

Discover more about diseases related to actin, gamma 2 Antibody (H00000072-D01P).
 

Pathways for actin, gamma 2 Antibody (H00000072-D01P)

View related products by pathway.

Blogs on actin, gamma 2

There are no specific blogs for actin, gamma 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our actin, gamma 2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ACTG2
Entrez
Uniprot