ACOX2 Antibody

Images

 
Western Blot: ACOX2 Antibody [NBP1-88364] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry: ACOX2 Antibody [NBP1-88364] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACOX2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHSYPEFSCKDNYFMTQN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACOX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACOX2 Protein (NBP1-88364PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACOX2 Antibody

  • 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA 24-hydroxylase
  • 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA oxidase
  • 3-alpha
  • 7-alpha
  • acyl-CoA oxidase 2, branched chain
  • acyl-Coenzyme A oxidase 2, branched chain
  • BCOX
  • BRCACOXTHCA-CoA oxidase
  • BRCOX
  • EC 1.17.99.3
  • peroxisomal acyl-coenzyme A oxidase 2,3-alpha
  • peroxisomal branched chain acyl-CoA oxidase
  • THCCox
  • Trihydroxycoprostanoyl-CoA oxidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85901
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
MAB9120
Species: Hu
Applications: ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-59576
Species: Hu
Applications: WB, IHC
AF5540
Species: Mu
Applications: WB
AF4937
Species: Hu
Applications: WB, IHC
NBP2-50218
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-50212
Species: Hu, Mu, Rt, Dr, Xp
Applications: WB, ELISA, IHC

Publications for ACOX2 Antibody (NBP1-88364) (0)

There are no publications for ACOX2 Antibody (NBP1-88364).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACOX2 Antibody (NBP1-88364) (0)

There are no reviews for ACOX2 Antibody (NBP1-88364). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACOX2 Antibody (NBP1-88364) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACOX2 Products

Bioinformatics Tool for ACOX2 Antibody (NBP1-88364)

Discover related pathways, diseases and genes to ACOX2 Antibody (NBP1-88364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOX2 Antibody (NBP1-88364)

Discover more about diseases related to ACOX2 Antibody (NBP1-88364).
 

Pathways for ACOX2 Antibody (NBP1-88364)

View related products by pathway.

PTMs for ACOX2 Antibody (NBP1-88364)

Learn more about PTMs related to ACOX2 Antibody (NBP1-88364).

Blogs on ACOX2

There are no specific blogs for ACOX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACOX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACOX2