ACOX2 Antibody


Western Blot: ACOX2 Antibody [NBP1-88364] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with more
Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP1-88364] - Staining in human liver and lymph node tissues using anti-ACOX2 antibody. Corresponding ACOX2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP1-88364] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP1-88364] - Staining of human lymph node shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ACOX2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHSYPEFSCKDNYFMTQN
Specificity of human ACOX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACOX2 Protein (NBP1-88364PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ACOX2 Antibody

  • 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA 24-hydroxylase
  • 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA oxidase
  • 3-alpha
  • 7-alpha
  • acyl-CoA oxidase 2, branched chain
  • acyl-Coenzyme A oxidase 2, branched chain
  • BCOX
  • BRCACOXTHCA-CoA oxidase
  • EC
  • peroxisomal acyl-coenzyme A oxidase 2,3-alpha
  • peroxisomal branched chain acyl-CoA oxidase
  • THCCox
  • Trihydroxycoprostanoyl-CoA oxidase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: ICC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACOX2 Antibody (NBP1-88364) (0)

There are no publications for ACOX2 Antibody (NBP1-88364).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACOX2 Antibody (NBP1-88364) (0)

There are no reviews for ACOX2 Antibody (NBP1-88364). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACOX2 Antibody (NBP1-88364) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ACOX2 Products

Bioinformatics Tool for ACOX2 Antibody (NBP1-88364)

Discover related pathways, diseases and genes to ACOX2 Antibody (NBP1-88364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOX2 Antibody (NBP1-88364)

Discover more about diseases related to ACOX2 Antibody (NBP1-88364).

Pathways for ACOX2 Antibody (NBP1-88364)

View related products by pathway.

PTMs for ACOX2 Antibody (NBP1-88364)

Learn more about PTMs related to ACOX2 Antibody (NBP1-88364).

Blogs on ACOX2

There are no specific blogs for ACOX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ACOX2 Antibody and receive a gift card or discount.


Gene Symbol ACOX2