ACOT7 Antibody

Images

 
Western Blot: ACOT7 Antibody [NBP1-89279] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-16
Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human rectum shows strong cytoplasmic positivity in peripheral nerves.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACOT7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSLSQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKAKRQGH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACOT7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACOT7 Protein (NBP1-89279PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACOT7 Antibody

  • ACH1
  • acyl-CoA thioesterase 7CTE-IIa
  • BACHEC 3.1.2.2
  • brain acyl CoA hydrolase
  • Brain acyl-CoA hydrolase
  • CTE-IILACH
  • cytosolic acyl coenzyme A thioester hydrolase
  • hBACH
  • Long chain acyl-CoA thioester hydrolase
  • long chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2898
Species: Mu
Applications: WB, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for ACOT7 Antibody (NBP1-89279) (0)

There are no publications for ACOT7 Antibody (NBP1-89279).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACOT7 Antibody (NBP1-89279) (0)

There are no reviews for ACOT7 Antibody (NBP1-89279). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACOT7 Antibody (NBP1-89279) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACOT7 Products

Bioinformatics Tool for ACOT7 Antibody (NBP1-89279)

Discover related pathways, diseases and genes to ACOT7 Antibody (NBP1-89279). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOT7 Antibody (NBP1-89279)

Discover more about diseases related to ACOT7 Antibody (NBP1-89279).
 

Pathways for ACOT7 Antibody (NBP1-89279)

View related products by pathway.

PTMs for ACOT7 Antibody (NBP1-89279)

Learn more about PTMs related to ACOT7 Antibody (NBP1-89279).

Blogs on ACOT7

There are no specific blogs for ACOT7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACOT7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACOT7