ACOT7 Antibody - BSA Free

Western Blot: ACOT7 Antibody [NBP1-89279] - Analysis using Anti-ACOT7 antibody NBP1-89279 (A) shows similar pattern to independent antibody NBP1-89278 (B).

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human cerebellum, cerebral cortex, kidney and pancreas using Anti-ACOT7 antibody NBP1-89279 (A) shows similar protein distribution across tissues to independent antibody NBP1-89278 (B).

Western Blot: ACOT7 Antibody [NBP1-89279] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-16

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human cerebral cortex shows strong positivity in neurons and neuropil.

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human pancreas shows weak to no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining in human cerebral cortex and pancreas tissues . Corresponding ACOT7 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACOT7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACOT7 Antibody - BSA Free (NBP1-89279) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSLSQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKAKRQGH
• Predicted Species: Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACOT7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ACOT7 Protein (NBP1-89279PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ACOT7 Antibody - BSA Free

• ACH1
• acyl-CoA thioesterase 7CTE-IIa
• BACHEC 3.1.2.2
• brain acyl CoA hydrolase
• Brain acyl-CoA hydrolase
• CTE-IILACH
• cytosolic acyl coenzyme A thioester hydrolase
• hBACH
• Long chain acyl-CoA thioester hydrolase
• long chain

Background

The ACOT7 gene encodes a member of the acyl coenzyme family. The encoded protein hydrolyzes the CoA thioester ofpalmitoyl-CoA and other long-chain fatty acids. Decreased expression of this gene may be associated with mesialtemporal lobe epilepsy. Alternatively

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACOT7