ACN9 Antibody


Western Blot: ACN9 Antibody [NBP2-14259] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ACN9 Antibody [NBP2-14259] - Immunofluorescent staining of human cell line SiHa shows localization to mitochondria.
Immunohistochemistry-Paraffin: ACN9 Antibody [NBP2-14259] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ACN9 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEAT KPNRQFSISESMKP
Specificity of human ACN9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ACN9 Protein (NBP2-14259PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ACN9 Antibody

  • ACN9 homolog (S. cerevisiae)
  • DC11
  • protein ACN9 homolog, mitochondrial


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACN9 Antibody (NBP2-14259) (0)

There are no publications for ACN9 Antibody (NBP2-14259).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACN9 Antibody (NBP2-14259) (0)

There are no reviews for ACN9 Antibody (NBP2-14259). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACN9 Antibody (NBP2-14259) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ACN9 Products

Bioinformatics Tool for ACN9 Antibody (NBP2-14259)

Discover related pathways, diseases and genes to ACN9 Antibody (NBP2-14259). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACN9 Antibody (NBP2-14259)

Discover more about diseases related to ACN9 Antibody (NBP2-14259).

Pathways for ACN9 Antibody (NBP2-14259)

View related products by pathway.

Blogs on ACN9

There are no specific blogs for ACN9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ACN9 Antibody and receive a gift card or discount.


Gene Symbol ACN9