ACSS1 Antibody

Images

 
Western Blot: ACSS1 Antibody [NBP2-30635] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: MOLT-4
Immunohistochemistry: ACSS1 Antibody [NBP2-30635] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACSS1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AQPGSYPALSAQAAREPAAFWGPLARDTLVWDTPYHTVWDCDFSTGKIGWFLGGQLNVSVNCLDQHVRKSPESVALIWERDEPGTEVRITYRELLETT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACSS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACSS1 Protein (NBP2-30635PEP)
Publications
Read Publication using
NBP2-30635 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25584894).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACSS1 Antibody

  • ACAS2L
  • AceCS2
  • AceCS2L
  • Acetate--CoA ligase 2
  • Acetyl-CoA synthetase 2
  • acetyl-Coenzyme A synthetase 2 (AMP forming)-like
  • acetyl-coenzyme A synthetase 2-like, mitochondrial
  • acyl-CoA synthetase short-chain family member 1dJ568C11.3
  • EC 6.2.1
  • EC 6.2.1.1
  • FLJ45659
  • KIAA1846
  • MGC33843

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83530
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-32462
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-07047
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-31029
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
H00007134-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-14259
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33380
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-16861
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30635
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ACSS1 Antibody (NBP2-30635)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ACSS1 Antibody (NBP2-30635) (0)

There are no reviews for ACSS1 Antibody (NBP2-30635). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSS1 Antibody (NBP2-30635) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACSS1 Products

Bioinformatics Tool for ACSS1 Antibody (NBP2-30635)

Discover related pathways, diseases and genes to ACSS1 Antibody (NBP2-30635). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSS1 Antibody (NBP2-30635)

Discover more about diseases related to ACSS1 Antibody (NBP2-30635).
 

Pathways for ACSS1 Antibody (NBP2-30635)

View related products by pathway.

PTMs for ACSS1 Antibody (NBP2-30635)

Learn more about PTMs related to ACSS1 Antibody (NBP2-30635).
 

Research Areas for ACSS1 Antibody (NBP2-30635)

Find related products by research area.

Blogs on ACSS1

There are no specific blogs for ACSS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACSS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSS1
Uniprot