ACK1 Antibody

Images

 
Immunohistochemistry-Paraffin: ACK1 Antibody [NBP1-90822] - Staining of human lateral ventricle shows strong nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACK1 Protein (NBP1-90822PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACK1 Antibody

  • ACK-1
  • ACK1ACKp21cdc42Hs
  • activated CDC42 kinase 1
  • activated Cdc42-associated kinase 1
  • activated p21cdc42Hs kinase
  • EC 2.7.10
  • EC 2.7.10.2
  • FLJ44758
  • FLJ45547
  • Tyrosine kinase non-receptor protein 2
  • tyrosine kinase, non-receptor, 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP2-16372
Species: Hu
Applications: WB, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB38461
Species: Hu
Applications: WB, IHC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P

Publications for ACK1 Antibody (NBP1-90822) (0)

There are no publications for ACK1 Antibody (NBP1-90822).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACK1 Antibody (NBP1-90822) (0)

There are no reviews for ACK1 Antibody (NBP1-90822). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ACK1 Antibody (NBP1-90822) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACK1 Products

Bioinformatics Tool for ACK1 Antibody (NBP1-90822)

Discover related pathways, diseases and genes to ACK1 Antibody (NBP1-90822). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACK1 Antibody (NBP1-90822)

Discover more about diseases related to ACK1 Antibody (NBP1-90822).
 

Pathways for ACK1 Antibody (NBP1-90822)

View related products by pathway.

PTMs for ACK1 Antibody (NBP1-90822)

Learn more about PTMs related to ACK1 Antibody (NBP1-90822).
 

Research Areas for ACK1 Antibody (NBP1-90822)

Find related products by research area.

Blogs on ACK1

There are no specific blogs for ACK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNK2