ACAA2 Antibody

Images

 
Western Blot: ACAA2 Antibody [NBP1-54746] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACAA2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ACAA2(acetyl-Coenzyme A acyltransferase 2) The peptide sequence was selected from the N terminal of ACAA2. Peptide sequence ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACAA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ACAA2 and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACAA2 Antibody

  • 3-ketoacyl-CoA thiolase, mitochondrial
  • acetyl-CoA acyltransferase 2
  • Acetyl-CoA acyltransferase
  • acetyl-Coenzyme A acyltransferase 2
  • beta ketothiolase
  • beta-ketothiolase
  • DSAEC
  • EC 2.3.1
  • EC 2.3.1.16
  • FLJ35992
  • FLJ95265
  • Mitochondrial 3-oxoacyl-CoA thiolase
  • mitochondrial 3-oxoacyl-Coenzyme A thiolase
  • T1

Background

ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-87283
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for ACAA2 Antibody (NBP1-54746) (0)

There are no publications for ACAA2 Antibody (NBP1-54746).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAA2 Antibody (NBP1-54746) (0)

There are no reviews for ACAA2 Antibody (NBP1-54746). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACAA2 Antibody (NBP1-54746) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACAA2 Products

Bioinformatics Tool for ACAA2 Antibody (NBP1-54746)

Discover related pathways, diseases and genes to ACAA2 Antibody (NBP1-54746). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAA2 Antibody (NBP1-54746)

Discover more about diseases related to ACAA2 Antibody (NBP1-54746).
 

Pathways for ACAA2 Antibody (NBP1-54746)

View related products by pathway.

PTMs for ACAA2 Antibody (NBP1-54746)

Learn more about PTMs related to ACAA2 Antibody (NBP1-54746).

Blogs on ACAA2

There are no specific blogs for ACAA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACAA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAA2
Uniprot