ABP1/AOC1 Antibody


Western Blot: ABP1 Antibody [NBP1-89068] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-11
Immunohistochemistry-Paraffin: ABP1 Antibody [NBP1-89068] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ABP1/AOC1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TKPLHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSWLIIQRYVEGYFLHPTGLELLVDHGSTDAGHWA
Specificity of human ABP1/AOC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ABP1/AOC1 Protein (NBP1-89068PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ABP1/AOC1 Antibody

  • ABP
  • ABP1
  • amiloride binding protein 1 (amine oxidase (copper-containing))
  • Amiloride-binding protein
  • amiloride-sensitive amine oxidase [copper-containing]
  • amiloride-sensitive amine oxidase
  • AOC1
  • AOC1DAOamiloride-binding protein-1
  • DAO
  • DAO1
  • Diamine Oxidase
  • EC 1.4.3
  • EC
  • Histaminase
  • KAO
  • Kidney amine oxidase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ABP1/AOC1 Antibody (NBP1-89068) (0)

There are no publications for ABP1/AOC1 Antibody (NBP1-89068).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABP1/AOC1 Antibody (NBP1-89068) (0)

There are no reviews for ABP1/AOC1 Antibody (NBP1-89068). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABP1/AOC1 Antibody (NBP1-89068) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ABP1/AOC1 Products

Bioinformatics Tool for ABP1/AOC1 Antibody (NBP1-89068)

Discover related pathways, diseases and genes to ABP1/AOC1 Antibody (NBP1-89068). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABP1/AOC1 Antibody (NBP1-89068)

Discover more about diseases related to ABP1/AOC1 Antibody (NBP1-89068).

Pathways for ABP1/AOC1 Antibody (NBP1-89068)

View related products by pathway.

PTMs for ABP1/AOC1 Antibody (NBP1-89068)

Learn more about PTMs related to ABP1/AOC1 Antibody (NBP1-89068).

Blogs on ABP1/AOC1

There are no specific blogs for ABP1/AOC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABP1/AOC1 Antibody and receive a gift card or discount.


Gene Symbol ABP1