ABL2 Antibody (2L9C6)

Western Blot: ABL2 Antibody (2L9C6) [NBP3-33205] - Western blot analysis of various lysates using ABL2 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 2L9C6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

ABL2 Antibody (2L9C6) Summary

• Description: Novus Biologicals Rabbit ABL2 Antibody (2L9C6) (NBP3-33205) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ABL2 (P42684).
  
  Sequence:
  KGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ABL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 128 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ABL2 Antibody (2L9C6)

• Abelson murine leukemia viral (v-abl) oncogene homolog 2
• Abelson murine leukemia viral oncogene homolog 2
• Abelson-related gene protein
• Abelson-relatedgene)
• ABL2
• ABLL
• arg tyrosine kinase
• ARG
• EC 2.7.10
• EC 2.7.10.2
• FLJ22224
• FLJ31718
• FLJ41441
• tyrosine-protein kinase ABL2
• Tyrosine-protein kinase ARG
• v-abl Abelson murine leukemia viral oncogene homolog 2

Background

The gene product is a cytoplasmic tyrosine kinase which is closely related to but distinct from ABL1. The similarity of the proteins includes the tyrosine kinase domains and extends amino-terminal to include the SH2 and SH3 domains. This gene is expressed in both normal and tumor cells. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABL2