ABCG5 Recombinant Protein Antigen

Images

 
There are currently no images for ABCG5 Protein (NBP1-80712PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ABCG5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCG5.

Source: E. coli

Amino Acid Sequence: IHQPRSELFQLFDKIAILSFGELIFCGTPAEMLDFFNDCGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPMVPFKTKDSPGVFSKLGVLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCG5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80712.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCG5 Recombinant Protein Antigen

  • ATP-binding cassette sub-family G member 5
  • ATP-binding cassette, sub-family G (WHITE), member 5
  • ATP-binding cassette, subfamily G, member 5
  • sterolin 1
  • sterolin-1
  • STSL

Background

The protein encoded by the ABCG5 gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABCproteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into sevendistinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily.The protein encoded by this gene functions as a half-transporter to limit intestinal absorption and promote biliaryexcretion of sterols. It is expressed in a tissue-specific manner in the liver, colon, and intestine. This gene istandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG8. Mutations in this gene maycontribute to sterol accumulation and atheroschlerosis, and have been observed in patients with sitosterolemia.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71706
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NB400-128
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-89319
Species: Hu
Applications: IHC,  IHC-P
NBP2-30876
Species: Hu
Applications: IHC,  IHC-P
MAB9120
Species: Hu
Applications: ICC
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NB400-132
Species: ChHa, Ha, Hu, Pm, Mu, Rb, Rt
Applications: Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, In vitro, In vivo, Simple Western, WB
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PLA, Simple Western, WB
NBP2-66888
Species: Hu, Mu, Rt
Applications:  IHC-P, IP, Simple Western, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-69023
Species: Mu
Applications: WB
NBP2-45981
Species: Hu
Applications: IHC,  IHC-P
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-54446
Species: Ch, Hu
Applications: ELISA, GS, ICC/IF, IP, WB
NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-80712PEP
Species: Hu
Applications: AC

Publications for ABCG5 Protein (NBP1-80712PEP) (0)

There are no publications for ABCG5 Protein (NBP1-80712PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCG5 Protein (NBP1-80712PEP) (0)

There are no reviews for ABCG5 Protein (NBP1-80712PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCG5 Protein (NBP1-80712PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCG5 Products

Array NBP1-80712PEP

Research Areas for ABCG5 Protein (NBP1-80712PEP)

Find related products by research area.

Blogs on ABCG5.

ABCG8: Cholesterol's Fate
The ATP-binding cassette (ABC) transporter genes are key gatekeeper molecules that regulate the amount of dietary cholesterol retained by the body. They are a multifamily comprised of cAMP-dependent anion transporter cell membrane proteins that monito...  Read full blog post.

ABCG2: A Tumor Protector
ABCG2 is a member of the ATP-binding cassette (ABC) transporter superfamily. Among ABC transporters ABCG2 is particularly interesting for its potential role in protecting cancer stem cells and its complex oligomeric structure (1). The ABC transporters...  Read full blog post.

Exploring how ABCG8 Affects Heart Disease
The high prevalence of atherosclerosis in developed nations is not breaking news; it has been well established that heart disease is the leading cause of death in the United States, and it presents a major socioeconomic burden. Investigators across th...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABCG5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCG5