ABCG5 Antibody

Product Discontinued

ABCG5 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ABCG5 (ATP-binding cassette, sub-family G (WHITE), member 5) The peptide sequence was selected from the middle region of ABCG5)(50ug). Peptide sequence CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH.
• Predicted Species: Guinea Pig (100%), Equine (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCG5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.2-1 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against ABCG5 and was validated on Western blot.
• Theoretical MW: 72 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25261526).

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ABCG5 Antibody

• ATP-binding cassette sub-family G member 5
• ATP-binding cassette, sub-family G (WHITE), member 5
• ATP-binding cassette, subfamily G, member 5
• sterolin 1
• sterolin-1
• STSL

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions as a half-transporter to limit intestinal absorption and promote biliary excretion of sterols. It is expressed in a tissue-specific manner in the liver, colon, and intestine. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG8. Mutations in this gene may contribute to sterol accumulation and atheroschlerosis, and have been observed in patients with sitosterolemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ABCG5 Antibody (NBP1-59803)(1)

Publication using NBP1-59803

• Huang Y, Wang J, Quan G et al. Lactobacillus acidophilus ATCC 4356 prevents atherosclerosis via inhibition of intestinal cholesterol absorption in Apolipoprotein E-knockout mice. Appl. Environ. Microbiol. 2014-09-26 [PMID: 25261526] (WB, Mouse)
  
  Details:
  ABCG5 antibody used for WB on total proteins isolated from small intestines of ApoE?/? mice treated with or without Lactobacillus acidophilus / ATCC 4356 (FIG 7C).

Bioinformatics

• Gene Symbol: ABCG5
• Entrez:
  • 64240(Mouse)
• Uniprot:
  • Q9H222(Human)