ABCE1 Antibody

Images

 
Western Blot: ABCE1 Antibody [NBP2-58061] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ABCE1 Antibody [NBP2-58061] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCE1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINP
Specificity
Specificity of human ABCE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCE1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ABCE1 Recombinant Protein Antigen (NBP2-58061PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ABCE1 Antibody

  • 2'-5'-oligoadenylate-binding protein
  • ATP-binding cassette, sub-family E (OABP), member 1
  • huHP68
  • OABP
  • Ribonuclease 4 inhibitor
  • ribonuclease L (2'-5'-oligoisoadenylate synthetase-dependent) inhibitor
  • RLIABC38
  • RNase L inhibitor
  • RNASEL1
  • RNASELIRNS4IATP-binding cassette sub-family E member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-351
Species: Hu, Ha, Pm, Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
NBP1-31113
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-86906
Species: Hu
Applications: WB, IHC, IHC-P
AF5059
Species: Hu
Applications: WB, IHC
NBP1-77687
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-89314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, PEP-ELISA
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-53246
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NB400-115
Species: Hu, Mu, Ye
Applications: WB, Simple Western, ICC/IF, KD
NBP1-87258
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P

Publications for ABCE1 Antibody (NBP2-58061) (0)

There are no publications for ABCE1 Antibody (NBP2-58061).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCE1 Antibody (NBP2-58061) (0)

There are no reviews for ABCE1 Antibody (NBP2-58061). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABCE1 Antibody (NBP2-58061) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ABCE1 Products

Bioinformatics Tool for ABCE1 Antibody (NBP2-58061)

Discover related pathways, diseases and genes to ABCE1 Antibody (NBP2-58061). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCE1 Antibody (NBP2-58061)

Discover more about diseases related to ABCE1 Antibody (NBP2-58061).
 

Pathways for ABCE1 Antibody (NBP2-58061)

View related products by pathway.

PTMs for ABCE1 Antibody (NBP2-58061)

Learn more about PTMs related to ABCE1 Antibody (NBP2-58061).
 

Research Areas for ABCE1 Antibody (NBP2-58061)

Find related products by research area.

Blogs on ABCE1

There are no specific blogs for ABCE1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCE1