ABCC5 Antibody

Images

 
Immunohistochemistry-Paraffin: ABCC5 Antibody [NBP2-14251] Staining of human kidney shows strong membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCC5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDA SMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFS WLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ABCC5 Protein (NBP2-14251PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABCC5 Antibody

  • ATP-binding cassette sub-family C member 5
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 5
  • canalicular multispecific organic anion transporter C
  • EST277145
  • MOAT-CABC33
  • MRP5MOATC
  • multidrug resistance-associated protein 5
  • Multi-specific organic anion transporter C
  • pABC11
  • SMRPDKFZp686C1782

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-82623
Species: Hu
Applications: IHC, IHC-P
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC

Publications for ABCC5 Antibody (NBP2-14251) (0)

There are no publications for ABCC5 Antibody (NBP2-14251).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCC5 Antibody (NBP2-14251) (0)

There are no reviews for ABCC5 Antibody (NBP2-14251). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ABCC5 Antibody (NBP2-14251) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCC5 Products

Bioinformatics Tool for ABCC5 Antibody (NBP2-14251)

Discover related pathways, diseases and genes to ABCC5 Antibody (NBP2-14251). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCC5 Antibody (NBP2-14251)

Discover more about diseases related to ABCC5 Antibody (NBP2-14251).
 

Pathways for ABCC5 Antibody (NBP2-14251)

View related products by pathway.

PTMs for ABCC5 Antibody (NBP2-14251)

Learn more about PTMs related to ABCC5 Antibody (NBP2-14251).
 

Research Areas for ABCC5 Antibody (NBP2-14251)

Find related products by research area.

Blogs on ABCC5

There are no specific blogs for ABCC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC5