ABCC12 Antibody

Images

 
Immunohistochemistry-Paraffin: ABCC12 Antibody [NBP1-81034] - Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

ABCC12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GPYLISDLDQRGRRRSFAERYDPSLKTMIPVRPCARLAPNPVDDAGLLSFATFSWLTPVMVKGYRQRLTVDTLPPLSTYDSSDTNAKRFRV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCC12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
ABCC12 Protein (NBP1-81034PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (84%)

Alternate Names for ABCC12 Antibody

  • ATP-binding cassette transporter sub-family C member 12
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 12
  • MGC27071
  • MRP9ATP-binding cassette sub-family C member 12
  • multidrug resistance-associated protein 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP
NBP1-82623
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46467
Species: Hu
Applications: WB, IHC
NB100-1471
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB25031
Species: Hu
Applications: WB, IHC, IP
19600002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-48743
Species: Hu
Applications: IHC
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NBP1-42348
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-1036
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, B/N, ICC/IF, IHC, IHC-P, IP

Publications for ABCC12 Antibody (NBP1-81034) (0)

There are no publications for ABCC12 Antibody (NBP1-81034).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCC12 Antibody (NBP1-81034) (0)

There are no reviews for ABCC12 Antibody (NBP1-81034). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ABCC12 Antibody (NBP1-81034) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCC12 Antibody Products

Related Products by Gene

Bioinformatics Tool for ABCC12 Antibody (NBP1-81034)

Discover related pathways, diseases and genes to ABCC12 Antibody (NBP1-81034). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCC12 Antibody (NBP1-81034)

Discover more about diseases related to ABCC12 Antibody (NBP1-81034).
 

Pathways for ABCC12 Antibody (NBP1-81034)

View related products by pathway.

Blogs on ABCC12

There are no specific blogs for ABCC12, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ABCC12

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81034 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought