ABCC11 Antibody - BSA Free

Immunohistochemistry-Paraffin: ABCC11 Antibody [NBP2-38193] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ABCC11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ABCC11 Antibody - BSA Free (NBP2-38193) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-ABCC11 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NGKICENGTHSELMQKKGKYAQLIQKMHKEATSDMLQDTAKIAEKPKVESQALATSLEESLNGNAVPEHQLTQE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCC11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: Use in ICC/IF reported in scientific literature (PMID:35447320) For IHC-Paraffin, HIER pH 6 retrieval is recommended..
• Control Peptide:

  ABCC11 Recombinant Protein Antigen (NBP2-38193PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ABCC11 Antibody - BSA Free

• ATP-binding cassette protein C11
• ATP-binding cassette transporter MRP8
• ATP-binding cassette transporter sub-family C member 11
• ATP-binding cassette, sub-family C (CFTR/MRP), member 11
• EWWD
• MRP8ATP-binding cassette sub-family C member 11
• Multidrug resistance-associated protein 8
• multi-resistance protein 8
• WW

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This ABC full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. The product of this gene participates in physiological processes involving bile acids, conjugated steroids, and cyclic nucleotides. In addition, a SNP in this gene is responsible for determination of human earwax type. This gene and family member ABCC12 are determined to be derived by duplication and are both localized to chromosome 16q12.1. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ABCC11 Antibody (NBP2-38193)(1)

Publication using NBP2-38193

• KrUmmel B, von Hanstein AS, PlOtz T et al. Differential effects of saturated and unsaturated free fatty acids on ferroptosis in rat beta-cells The Journal of nutritional biochemistry 2022-04-18 [PMID: 35447320] (ICC/IF, Rat)

Bioinformatics

• Gene Symbol: ABCC11
• Uniprot:
  • Q96J66(Human)