ABCC11 Antibody


Immunohistochemistry-Paraffin: ABCC11 Antibody [NBP1-82623] - Staining of human liver shows strong membranous positivity in bile duct cells.
Immunohistochemistry-Paraffin: ABCC11 Antibody [NBP1-82623] - Staining of human breast shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: ABCC11 Antibody [NBP1-82623] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

ABCC11 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSK
Specificity of human ABCC11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ABCC11 Protein (NBP1-82623PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ABCC11 Antibody

  • ATP-binding cassette protein C11
  • ATP-binding cassette transporter MRP8
  • ATP-binding cassette transporter sub-family C member 11
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 11
  • EWWD
  • MRP8ATP-binding cassette sub-family C member 11
  • Multidrug resistance-associated protein 8
  • multi-resistance protein 8
  • WW


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Simple Western, IHC, ICC
Species: Mu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ABCC11 Antibody (NBP1-82623) (0)

There are no publications for ABCC11 Antibody (NBP1-82623).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCC11 Antibody (NBP1-82623) (0)

There are no reviews for ABCC11 Antibody (NBP1-82623). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ABCC11 Antibody (NBP1-82623) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ABCC11 Antibody (NBP1-82623)

Discover related pathways, diseases and genes to ABCC11 Antibody (NBP1-82623). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCC11 Antibody (NBP1-82623)

Discover more about diseases related to ABCC11 Antibody (NBP1-82623).

Pathways for ABCC11 Antibody (NBP1-82623)

View related products by pathway.

PTMs for ABCC11 Antibody (NBP1-82623)

Learn more about PTMs related to ABCC11 Antibody (NBP1-82623).

Blogs on ABCC11

There are no specific blogs for ABCC11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABCC11 Antibody and receive a gift card or discount.


Gene Symbol ABCC11