ABCA10 Antibody

Images

 
Immunohistochemistry-Paraffin: ABCA10 Antibody [NBP1-83953] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells, neuropil was moderately stained.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCA10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MYKVTRETHCWEFSPSMYFLSLEQIPKTPLTSLLIVNNTGSNIEDLVHSLKCQDIVLEIDDFRNRNGSDDPSYNGAIIVSGDQKDYRFSVACNTKKLNC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCA10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ABCA10 Protein (NBP1-83953PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABCA10 Antibody

  • ATP-binding cassette A10
  • ATP-binding cassette sub-family A member 10
  • ATP-binding cassette, sub-family A (ABC1), member 10
  • EC 3.6.3
  • EC 3.6.3.41
  • EST698739

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NBP2-55225
Species: Hu
Applications: ICC/IF
NBP2-30843
Species: Hu
Applications: WB, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-91641
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36770
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP2-14249
Species: Hu
Applications: IHC, IHC-P
NBP1-77687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NBP1-59809
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33435
Species: Hu
Applications: WB
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-22403
Species: Mu
Applications: WB, ICC/IF, IHC
NB400-166
Species: Mu
Applications: WB, Flow, IHC-P
NBP1-83953
Species: Hu
Applications: IHC, IHC-P

Publications for ABCA10 Antibody (NBP1-83953) (0)

There are no publications for ABCA10 Antibody (NBP1-83953).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA10 Antibody (NBP1-83953) (0)

There are no reviews for ABCA10 Antibody (NBP1-83953). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ABCA10 Antibody (NBP1-83953) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCA10 Products

Bioinformatics Tool for ABCA10 Antibody (NBP1-83953)

Discover related pathways, diseases and genes to ABCA10 Antibody (NBP1-83953). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCA10 Antibody (NBP1-83953)

Discover more about diseases related to ABCA10 Antibody (NBP1-83953).
 

Pathways for ABCA10 Antibody (NBP1-83953)

View related products by pathway.

Research Areas for ABCA10 Antibody (NBP1-83953)

Find related products by research area.

Blogs on ABCA10

There are no specific blogs for ABCA10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCA10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCA10
Entrez
Uniprot