ABCC9 Antibody (S319A-14)


Western Blot: ABCC9 Antibody (S319A-14) [NBP2-22403] - analysis of Rat Brain Membrane showing detection of 120 kDa SUR2A protein using Mouse Anti-SUR2A Monoclonal Antibody, Clone S319A-14. Lane 1: MW Ladder. Lane 2: Rat more
Immunocytochemistry/ Immunofluorescence: ABCC9 Antibody (S319A-14) [NBP2-22403] - Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-SUR2A more

Product Details

Reactivity Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
1 mg/ml

ABCC9 Antibody (S319A-14) Summary

Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Detects approx 120kDa. Does not cross-react with SUR2B.
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
Application Notes
1 ug/ml of SUR2A Antibody was sufficient for detection of SUR2A in 20 ug of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary Antibody.
Read Publication using
NBP2-22403 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.4) and 50% Glycerol
0.09% Sodium Azide
1 mg/ml
Protein G purified

Alternate Names for ABCC9 Antibody (S319A-14)

  • ABC37
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 9
  • CMD1OATP-binding cassette transporter sub-family C member 9
  • EC
  • FLJ36852
  • Sulfonylurea receptor 2
  • sulfonylurea receptor 2A
  • SUR2ATP-binding cassette sub-family C member 9


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB (-), ChIP, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for ABCC9 Antibody (NBP2-22403)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for ABCC9 Antibody (NBP2-22403) (0)

There are no reviews for ABCC9 Antibody (NBP2-22403). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABCC9 Antibody (NBP2-22403) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ABCC9 Antibody (NBP2-22403)

Discover related pathways, diseases and genes to ABCC9 Antibody (NBP2-22403). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCC9 Antibody (NBP2-22403)

Discover more about diseases related to ABCC9 Antibody (NBP2-22403).

Pathways for ABCC9 Antibody (NBP2-22403)

View related products by pathway.

PTMs for ABCC9 Antibody (NBP2-22403)

Learn more about PTMs related to ABCC9 Antibody (NBP2-22403).

Blogs on ABCC9

There are no specific blogs for ABCC9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABCC9 Antibody (S319A-14) and receive a gift card or discount.


Gene Symbol ABCC9