53BP2 Antibody - BSA Free

Western Blot: 53BP2 Antibody [NBP3-37959] - Western blot analysis of various lysates using 53BP2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

53BP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit 53BP2 Antibody - BSA Free (NBP3-37959) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-330 of TP53BP2 (NP_001026855.2).
  
  Sequence:
  RALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKEN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TP53BP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 126 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for 53BP2 Antibody - BSA Free

• apoptosis-stimulating protein of p53, 2
• ASPP2P53BP2,53BP2apoptosis-stimulating of p53 protein 2
• Bbp
• Bcl2-binding protein
• p53-binding protein 2
• p53BP2
• PPP1R13A
• Renal carcinoma antigen NY-REN-51
• tumor protein p53 binding protein, 2
• tumor protein p53-binding protein, 2
• Tumor suppressor p53-binding protein 2

Background

53BP2 encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TP53BP2