17 beta-HSD1/HSD17B1 Antibody (2E5)

Images

 
Western Blot: 17 beta-HSD1/HSD17B1 Antibody (2E5) [H00003292-M03] - Analysis of HSD17B1 expression in Jurkat (Cat # L017V1).
Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody (2E5) [H00003292-M03] - Analysis of monoclonal antibody to HSD17B1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml
Sandwich ELISA: 17 beta-HSD1/HSD17B1 Antibody (2E5) [H00003292-M03] - Detection limit for recombinant GST tagged HSD17B1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
2E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

17 beta-HSD1/HSD17B1 Antibody (2E5) Summary

Immunogen
HSD17B1 (NP_000404, 189 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF
Specificity
HSD17B1 - hydroxysteroid (17-beta) dehydrogenase 1 (2E5)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HSD17B1
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publications using H00003292-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 17 beta-HSD1/HSD17B1 Antibody (2E5)

  • 17 betaHSD1
  • 17 beta-HSD1
  • 17-beta-HSD 1
  • 17-beta-hydroxysteroid dehydrogenase type 1
  • 20 alpha-hydroxysteroid dehydrogenase
  • 20-alpha-HSD
  • E17KSR
  • E2DH
  • EC 1.1.1.62
  • EDH17B1
  • EDH17B2
  • EDH17B2EDHB17
  • EDHB17
  • estradiol 17-beta-dehydrogenase 1
  • estradiol 17-beta-dehydrogenase-1
  • HSD17
  • HSD17B1
  • hydroxysteroid (17-beta) dehydrogenase 1 isoform
  • hydroxysteroid (17-beta) dehydrogenase 1
  • MGC138140
  • Placental 17-beta-hydroxysteroid dehydrogenase
  • SDR28C1
  • short chain dehydrogenase/reductase family 28CE, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1596
Species: Hu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-41387
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-53246
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-24722
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85368
Species: Hu, RM
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-78644
Species: Hu, Rt, Po, Pm, Bv, Gt, Pm, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-305
Species: Hu, Mu, Pm, Rb
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-404
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP2-38770
Species: Hu, Mu
Applications: WB

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 17 beta-HSD1/HSD17B1 Antibody (H00003292-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional 17 beta-HSD1/HSD17B1 Products

Bioinformatics Tool for 17 beta-HSD1/HSD17B1 Antibody (H00003292-M03)

Discover related pathways, diseases and genes to 17 beta-HSD1/HSD17B1 Antibody (H00003292-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 17 beta-HSD1/HSD17B1 Antibody (H00003292-M03)

Discover more about diseases related to 17 beta-HSD1/HSD17B1 Antibody (H00003292-M03).
 

Pathways for 17 beta-HSD1/HSD17B1 Antibody (H00003292-M03)

View related products by pathway.

PTMs for 17 beta-HSD1/HSD17B1 Antibody (H00003292-M03)

Learn more about PTMs related to 17 beta-HSD1/HSD17B1 Antibody (H00003292-M03).

Blogs on 17 beta-HSD1/HSD17B1

There are no specific blogs for 17 beta-HSD1/HSD17B1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 17 beta-HSD1/HSD17B1 Antibody (2E5) and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B1
OMIM