15-PGDH/HPGD Antibody - BSA Free

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87062] - Analysis in human urinary bladder and cerebral cortex tissues using NBP1-87062 antibody. Corresponding HPGD RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87062] - Staining of human stomach shows moderate to strong cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87062] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87062] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Western Blot: 15-PGDH/HPGD Antibody [NBP1-87062] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Analysis using Anti-HPGD antibody NBP1-87062 (A) shows similar pattern to independent antibody NBP1-87061 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

15-PGDH/HPGD Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit 15-PGDH/HPGD Antibody - BSA Free (NBP1-87062) is a polyclonal antibody validated for use in IHC and WB. Anti-15-PGDH/HPGD Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPV
• Predicted Species: Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HPGD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  15-PGDH/HPGD Recombinant Protein Antigen (NBP1-87062PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for 15-PGDH/HPGD Antibody - BSA Free

• 15-hydroxyprostaglandin dehydrogenase [NAD+]
• 15PGDH
• 15-PGDH
• EC 1.1.1
• EC 1.1.1.141
• HPGD
• hydroxyprostaglandin dehydrogenase 15-(NAD)
• NAD+-dependent 15-hydroxyprostaglandin dehydrogenase
• PGDH1
• PGDH1PGDH
• Prostaglandin dehydrogenase 1
• SDR36C1
• short chain dehydrogenase/reductase family 36C, member 1

Background

15-PGDH (15-hydroxyprostaglandin dehydrogenase (NAD+)) is responsible for prostaglandin inactivation and supports the regulation of functions that are controled by prostaglandin levels. Specifically, 15PGDH catalyzes the chemical reaction to convert NAD+ to NADH and H+.

15-PGDH is a novel tumor suppressor in the COX-2 pathway. 15-PGDH is found in many normal tissues and appears to be down-regulated in colorectal and lung carcinoma tissue.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for 15-PGDH/HPGD Antibody (NBP1-87062)(2)

Publications using NBP1-87062

• Massoner P, Kugler KG, Unterberger K et al. Characterization of Transcriptional Changes in ERG Rearrangement-Positive Prostate Cancer Identifies the Regulation of Metabolic Sensors Such as Neuropeptide Y. PLoS One 2013-01-01 [PMID: 23390522]
• Wu CC, Hsu CW, Chen CD et al. Candidate Serological Biomarkers for Cancer Identified from the Secretomes of 23 Cancer Cell Lines and the Human Protein Atlas. Mol Cell Proteomics 2010-06-01 [PMID: 20124221]

Bioinformatics

• Gene Symbol: HPGD