11 beta-HSD1 Antibody - BSA Free

Western Blot: 11 beta-HSD1 Antibody [NBP2-48879] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining of human pancreas shows negative cytoplasmic positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining in human liver and pancreas tissues using anti-HSD11B1 antibody. Corresponding HSD11B1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Analysis in human liver and pancreas tissues using NBP2-48879 antibody. Corresponding HSD11B1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining of human skeletal muscle shows negative cytoplasmic positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

11 beta-HSD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSD11B1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:100 - 1:250
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  11 beta-HSD1 Recombinant Protein Antigen (NBP2-48879PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for 11 beta-HSD1 Antibody - BSA Free

• 11 betaHSD1
• 11 beta-HSD1
• 11-beta-hydroxysteroid dehydrogenase 1
• EC 1.1.1
• EC 1.1.1.146
• HDL
• HSD11B1
• HSD11HSD11B
• HSD11LMGC13539
• hydroxysteroid (11-beta) dehydrogenase 1
• member 1
• SDR26C1

Background

HSD11B1 is encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HSD11B1