11 beta-HSD1 Antibody

Images

 
Western Blot: 11 beta-HSD1 Antibody [NBP1-69644] - 11 Beta HSD1 This Anti-HSD11B1 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP1-69644] - Human liver at 5.0 ug/ml
Western Blot: 11 beta-HSD1 Antibody [NBP1-69644] - Antibody Titration: 2 ug/ml Positive control: Transient overexpression lysate of HSD11B1 and Non-overexpressed vector control lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

11 beta-HSD1 Antibody Summary

Immunogen
Synthetic peptides corresponding to 11 Beta HSD1(hydroxysteroid (11-beta) dehydrogenase 1) The peptide sequence was selected from the N terminal of 11 Beta HSD1. Peptide sequence QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD11B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against HSD11B1 and was validated on Western blot.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for 11 beta-HSD1 Antibody

  • 11 betaHSD1
  • 11 beta-HSD1
  • 11-beta-hydroxysteroid dehydrogenase 1
  • EC 1.1.1
  • EC 1.1.1.146
  • HDL
  • HSD11B1
  • HSD11HSD11B
  • HSD11LMGC13539
  • hydroxysteroid (11-beta) dehydrogenase 1
  • member 1
  • SDR26C1

Background

11 Beta HSD1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, 11 Beta HSD1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children.The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8630
Species: Hu
Applications: WB, IHC
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
7570-GH
Species: Hu
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69644
Species: Hu
Applications: WB, IHC, IHC-P

Publications for 11 beta-HSD1 Antibody (NBP1-69644) (0)

There are no publications for 11 beta-HSD1 Antibody (NBP1-69644).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 11 beta-HSD1 Antibody (NBP1-69644) (0)

There are no reviews for 11 beta-HSD1 Antibody (NBP1-69644). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 11 beta-HSD1 Antibody (NBP1-69644) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 11 beta-HSD1 Products

Bioinformatics Tool for 11 beta-HSD1 Antibody (NBP1-69644)

Discover related pathways, diseases and genes to 11 beta-HSD1 Antibody (NBP1-69644). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 11 beta-HSD1 Antibody (NBP1-69644)

Discover more about diseases related to 11 beta-HSD1 Antibody (NBP1-69644).
 

Pathways for 11 beta-HSD1 Antibody (NBP1-69644)

View related products by pathway.

PTMs for 11 beta-HSD1 Antibody (NBP1-69644)

Learn more about PTMs related to 11 beta-HSD1 Antibody (NBP1-69644).
 

Research Areas for 11 beta-HSD1 Antibody (NBP1-69644)

Find related products by research area.

Blogs on 11 beta-HSD1

There are no specific blogs for 11 beta-HSD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 11 beta-HSD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD11B1
Entrez
Uniprot