11 beta-HSD1 Antibody - BSA Free

Western Blot: 11 beta-HSD1 Antibody [NBP1-69644] - 11 Beta HSD1 This Anti-HSD11B1 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP1-69644] - Human liver at 5.0 ug/ml

Western Blot: 11 beta-HSD1 Antibody [NBP1-69644] - Antibody Titration: 2 ug/ml Positive control: Transient overexpression lysate of HSD11B1 and Non-overexpressed vector control lysate.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

11 beta-HSD1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to 11 Beta HSD1(hydroxysteroid (11-beta) dehydrogenase 1) The peptide sequence was selected from the N terminal of 11 Beta HSD1. Peptide sequence QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSD11B1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for 11 beta-HSD1 Antibody - BSA Free

• 11 betaHSD1
• 11 beta-HSD1
• 11-beta-hydroxysteroid dehydrogenase 1
• EC 1.1.1
• EC 1.1.1.146
• HDL
• HSD11B1
• HSD11HSD11B
• HSD11LMGC13539
• hydroxysteroid (11-beta) dehydrogenase 1
• member 1
• SDR26C1

Background

11 Beta HSD1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, 11 Beta HSD1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children.The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for 11 beta-HSD1 Antibody (NBP1-69644)(1)

Publication using NBP1-69644

• Lee KE, Jeong S, Yun SK et al. Synthesis of Kisspeptin-Mimicking Fragments and Investigation of their Skin Anti-Aging Effects Int J Mol Sci 2020-11-10 [PMID: 33182726] (IHC-P, Human)
  
  Details:
  Human skin explants were treated with antibody for immunohistochemistry after treated with Kisspeptin-10

Bioinformatics

• Gene Symbol: HSD11B1
• Uniprot:
  • P28845()