RINT1 Antibody

Images

 
Western Blot: RINT1 Antibody [NBP1-82312] - Analysis in human cell line U-251 MG.
Immunohistochemistry-Paraffin: RINT1 Antibody [NBP1-82312] - Staining of human Fallopian tube shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: RINT1 Antibody [NBP1-82312] - Staining of human fallopian tube shows strong membranous positivity in ciliated glandular cells.
Immunohistochemistry-Paraffin: RINT1 Antibody [NBP1-82312] - Staining of human bronchus shows strong positivity in apical membrane in respiratory epithelial cells.
Immunohistochemistry-Paraffin: RINT1 Antibody [NBP1-82312] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RINT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PCCSESGDERKNLEEKSDINVTVLIGSKQVSEGTDNGDLPSYVSAFIEKEVGNDLKSLKKLDKLIEQRTVSKMQLEEQVLTISSEIPKRIRSALKNAEESKQFLNQFLEQETHLFS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RINT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RINT1 Protein (NBP1-82312PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RINT1 Antibody

  • DKFZp667H2324
  • FLJ11785
  • HsRINT-1
  • RAD50 interactor 1hsRINT-1
  • RINT-1RAD50-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38751
Species: Hu
Applications: IHC, IHC-P, WB
H00053407-M13
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-87035
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82868
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83254
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82785
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-14335
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-147
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
NB100-81029
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-46580
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-15937
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-32493
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB

Publications for RINT1 Antibody (NBP1-82312) (0)

There are no publications for RINT1 Antibody (NBP1-82312).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RINT1 Antibody (NBP1-82312) (0)

There are no reviews for RINT1 Antibody (NBP1-82312). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RINT1 Antibody (NBP1-82312) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RINT1 Products

Bioinformatics Tool for RINT1 Antibody (NBP1-82312)

Discover related pathways, diseases and genes to RINT1 Antibody (NBP1-82312). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RINT1 Antibody (NBP1-82312)

Discover more about diseases related to RINT1 Antibody (NBP1-82312).
 

Pathways for RINT1 Antibody (NBP1-82312)

View related products by pathway.

PTMs for RINT1 Antibody (NBP1-82312)

Learn more about PTMs related to RINT1 Antibody (NBP1-82312).
 

Research Areas for RINT1 Antibody (NBP1-82312)

Find related products by research area.

Blogs on RINT1

There are no specific blogs for RINT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RINT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RINT1