ZNHIT3 Antibody - BSA Free

Western Blot: ZNHIT3 Antibody [NBP2-86564] - WB Suggested Anti-ZNHIT3 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Placenta

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZNHIT3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNHIT3 Antibody - BSA Free (NBP2-86564) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNHIT3. Peptide sequence: HKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNHIT3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZNHIT3 Antibody - BSA Free

• HNF-4a coactivator
• Thyroid hormone receptor interactor 3TR-interacting protein 3
• Thyroid receptor-interacting protein 3
• TRIP-3
• TRIP3thyroid receptor interacting protein 3
• zinc finger HIT domain-containing protein 3
• zinc finger, HIT domain containing 3
• zinc finger, HIT type 3
• zinc finger, HIT-type containing 3

Background

ZNHIT3/TRIP3 interacts with HNF-4 alpha, a transcription factor involved in glucose metabolism. As a protein associated with HNF-4, ZNHIT3/TRIP3 functions as a transcriptional coactivator. Alternate names for ZNHIT3/TRIP3 include Zinc finger HIT domain-containing protein 3, thyroid receptor-interacting protein 3, and HNF4a coactivator.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNHIT3